KEGG   Cronobacter sakazakii ES15: ES15_0214Help
Entry
ES15_0214         CDS       T02119                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ES15_0214 (puuE)
   00650 Butanoate metabolism
    ES15_0214 (puuE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ES15_0214 (puuE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ES15_0214 (puuE)
Enzymes [BR:csk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ES15_0214 (puuE)
Amino acid related enzymes [BR:csk01007]
 Aminotransferase (transaminase)
  Class III
   ES15_0214 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
237975..239240
Genome map
AA seq 421 aa AA seqDB search
MKNSELNQRRQSATPRGVGVMCSFYAEKADNATLWDVEGNEIIDFAAGIAVLNTGHRHPR
VVEAIENQLRAFTHTAYQIVPYESYVALAERINACAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTRRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVFHAQYPNALHGVSVD
DAMASLERIFKADIAPDQVAAIVLEPVQGEGGFNVAPPAFMEALRALCDEHGILLIADEV
QSGFARTGKLFAMEHYGMKPDLLTMAKSLAGGMPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEQENLCQRANELGQHLQEVLNQARTYCPAIAEVRGQGSMVAVEFND
PQTGKPSPEFTQEVLTRAREEGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALEILSRALG
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaattcagaattgaaccaacgtcgtcagagcgccaccccacgtggcgtcggcgtc
atgtgcagcttctatgccgaaaaagccgacaacgccaccctgtgggacgtggaaggcaac
gagattattgacttcgcagcggggatcgcggtgttgaacaccggccatcgtcacccgcgc
gtggtggaggctatcgaaaatcagctgcgcgcctttacgcacacggcgtaccagattgtc
ccttacgaaagctatgtggcgcttgcggagcgcatcaacgcctgcgcgccgattgacggc
ccggcgaagaccgcgttcttcaccaccggcgcggaagcggtggaaaacgccgtgaaaatc
gcgcgcgcgtatacccgccgccctggcttaatcacttttggcggcggcttccacgggcgc
acgtttatgacgatggcgctcaccggcaaagtggcgccgtacaaaatcggcttcggcccg
ttccctggctcggtgttccacgcgcaatacccgaacgcgctgcacggcgtgtcggtggac
gatgcgatggcaagccttgagcgtatttttaaagccgatatcgcaccggatcaggtggcg
gccattgtgctggagccagtgcagggcgaaggcggtttcaacgtcgcgccgccagcgttt
atggaggctctgcgcgcgctgtgcgatgagcacggcattctgctgattgccgatgaagta
cagagcggttttgcgcgcaccggcaaactgttcgcgatggagcattacggcatgaagccg
gatctgctgacgatggcgaaaagcctcgcgggcgggatgccgctctcgggcgtggtcggg
cgcgcggaagtgatggacgcgcctgcgccgggcggccttggcggtacctacgccggtaac
ccgctggcggtcgcggcggcgcacgcggtgctggatgtgattgagcaggaaaatctctgc
cagcgcgcgaacgagctgggccagcatctgcaagaggtgctcaaccaggcgcggacgtac
tgcccggcgattgccgaagtccgcgggcagggctcgatggtggcggtggagtttaacgat
ccgcagaccggcaagccgtcgcctgagtttacgcaggaagtgttgacgcgcgcccgtgaa
gaggggctgctgctgctgagctgtggcgtttacggcaacgttatccgtttcctttacccg
ctgaccattccggatgcgcagttcagcaaggcgctggagatcctctcccgcgcgctgggg
cgctaa

DBGET integrated database retrieval system