KEGG   Cyanobacterium stanieri: Cyast_0119Help
Entry
Cyast_0119        CDS       T02377                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
csn  Cyanobacterium stanieri
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cyast_0119
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyast_0119
Enzymes [BR:csn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cyast_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
128339..128674
Genome map
AA seq 111 aa AA seqDB search
MQTLPKERRYETLSYLPPLTDQQIVKQVQYLLDQGFIPAVEFEKDPQPNDHHWTLWKLPL
FNAFSAQDVLNEVRECKGQYSDSFIRVIGFDNLKQCQTMSFIVHKPNTTRF
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttacctaaagagcgtcgttacgaaactctctcttacttacctcctttaacc
gatcaacaaatcgttaaacaagttcaatacttattagatcaaggatttattcctgcagta
gaatttgaaaaagatcctcaacccaatgaccaccactggactctttggaagttaccttta
ttcaatgctttctctgctcaagatgtattaaacgaagttcgtgaatgtaaaggtcaatat
tctgattctttcatcagagttatcggttttgataacctcaaacagtgtcaaaccatgagt
tttattgttcacaaacctaacaccactcgtttctag

DBGET integrated database retrieval system