KEGG   Clostridium scatologenes: CSCA_4270Help
Entry
CSCA_4270         CDS       T03803                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
csq  Clostridium scatologenes
Brite
Translation factors [BR:csq03012]
 Eukaryotic Type
  Elongation factors
   CSCA_4270
 Prokaryotic Type
   CSCA_4270
Mitochondrial biogenesis [BR:csq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CSCA_4270
Exosome [BR:csq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CSCA_4270
  Exosomal proteins of breast cancer cells
   CSCA_4270
  Exosomal proteins of colorectal cancer cells
   CSCA_4270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4616887..4618080
Genome map
AA seq 397 aa AA seqDB search
MSKAKYERNKPHVNIGTIGHVDHGKTTLTAAITMVLAKEGKAEAFKYDEIDKAPEEKERG
ITINTAHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLASRVGVSYIVVFLNKADQVDDPELLELVEMEVRELLSEYEFPGDDIPIIVGSALKVIE
NPDDPEATKCIHELMAAVDSYIPTPERATDKAFLMPVEDVFTITGRGTVATGRVESGILK
VGDEVEIVGLKEEKGKTTVTGVEMFRKLLDQAMAGDNIGALLRGIQRDDIERGQVLAKPG
SVHPHKKFVGQVYVLKKEEGGRHTPFFNGYRPQFYFRTTDVTGSIALPEGVEMVMPGDHI
DMNVELITPVAMDEGLRFAIREGGRTVGSGVVTKIVE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagcaaaatatgaaagaaacaaaccacatgtaaacataggaacaataggacac
gtagatcatggtaagacaacattaacagcagcaataacaatggtgttagcaaaagaagga
aaagcagaagcatttaagtatgacgaaatagataaagcaccagaggaaaaagaaagagga
atcacaatcaacacagcacacgtagaatatgaaacagagaatagacattatgcacacgta
gattgtccaggacatgctgactatgtaaagaacatgataacaggagcagcacaaatggat
ggagcaatcttagtagtaagtgcagcagatggtccaatgccacaaacaagagaacatata
ctactagcatcaagagtaggagtaagttacatagtagtattcttaaataaagcagaccaa
gtagacgatccagaattattggaattagtagaaatggaagtaagagaattattaagtgag
tatgaattcccaggagatgatattccaataatagtaggaagtgcgttaaaagtaatagaa
aatccagatgatccagaagcaacaaaatgcatacatgaattaatggcagcagtagatagc
tatataccaacaccagaaagagcaacagataaagcattcttaatgccagtagaagatgta
ttcacaatcacaggaagaggaacagttgcaacaggaagagttgaaagtggaatactaaaa
gttggagacgaagtagaaatcgtaggattaaaagaagaaaaaggcaagacaacagtaaca
ggagtagaaatgttcagaaagcttcttgatcaagcaatggcaggagataacataggagca
ttactaagaggaatacaaagagatgacatcgaaagaggtcaagtattagcaaaaccaggt
tcagtacacccacacaagaaatttgtaggtcaagtgtacgtattaaagaaagaagaaggc
ggaagacatacaccattcttcaatggatatagaccacagttttatttcagaacaacagac
gtaacaggatcaatcgcattaccagaaggagtagaaatggttatgccaggagatcacata
gatatgaatgttgaattaataacaccagtagcaatggatgaaggattaagatttgcaata
agagaaggcggaagaacagtaggttcaggtgttgttactaaaattgttgagtaa

DBGET integrated database retrieval system