KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c46190Help
Entry
Cspa_c46190       CDS       T02467                                 

Gene name
ppm
Definition
(GenBank) phosphoenolpyruvate phosphomutase Ppm
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csr00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Cspa_c46190 (ppm)
Enzymes [BR:csr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Cspa_c46190 (ppm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5035189..5036487)
Genome map
AA seq 432 aa AA seqDB search
MKTVYVAMSADIIHQGHLNVLNEARKFGDVIVGLHTDDVIRGYWRNPIMKYEERKEVVSN
IKGVVSVIPQDSLDQVPNIREIKPDYVLHGDDWKEGVQKVLRDKVIEAIGEWGGKLVEVP
YTQGVSISKLDEELAQIGITPQMRMKSLKELIYSKKPVRILEAHNGLTGLIVEKTKVEKE
GRIKEFDGMWISSLCDSTAKGKPDIELVDLTSRLNTINDILEVTTKPIIVDGDTGGQIEH
FVYTVKTLERLGVSAIIIEDKTGLKKNSLFGTAVVQTQDTIEHFSDKIRAGREARVTSDF
MIISRIESLIAGAGMEDAIERAKAYIEAGTDGIMIHSKEKNGEEIIKFCRRYNGFENKVP
LVVVPTSYNFMKEDELIELGVSVVIYANHLIRSAYPAMVNTAKSILENGRSKEASINCMP
IKEILTLIPGGM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtttatgtagctatgagtgcagatattattcatcaaggacatttaaatgta
ttaaatgaagcaagaaaatttggagatgtaatagttggattgcatactgatgatgtaata
agaggatattggagaaatcctataatgaaatatgaagagagaaaagaagttgtaagcaat
atcaaaggggttgtatcagtaattcctcaagatagtttagatcaagtgcctaatattaga
gaaattaaacctgattatgttctgcatggtgatgattggaaagaaggagtacaaaaagta
cttagagataaagtaattgaagcaataggtgaatggggaggaaaacttgttgaggttcca
tatacccaaggagtttctatttcaaaattagatgaagaattggcgcagataggaataaca
cctcagatgagaatgaaaagtcttaaggaactaatttattccaaaaaaccagttaggata
cttgaagctcataatgggttgacaggacttatcgtagaaaaaacaaaggttgaaaaagaa
ggtagaataaaagagtttgatggtatgtggataagttctttatgtgattcaactgccaag
ggtaagccagatattgaattagtagatttaacttcaagattaaatacaattaatgatatt
ttggaagtcactacaaaacctataatagttgacggagatacaggtggacaaattgaacat
tttgtttatactgttaaaaccttagaaagattaggtgtatcagctattattattgaagat
aaaactggacttaagaaaaattcattatttggtacagctgttgttcaaacacaggatacc
atagaacatttttcagataagatcagagctggaagagaagctcgggttactagtgatttt
atgataatttcaagaattgaaagtttgattgcaggagctggaatggaagatgctattgaa
agggcaaaagcttatattgaggcaggaacagatggaattatgatccatagtaaagaaaaa
aatggtgaagagataataaaattttgtagaagatataatgggtttgaaaataaagttcca
ttagtagtagttcctacttcatataattttatgaaagaagatgaattaattgaattagga
gttagtgttgttatatatgcaaatcatttaatccgaagtgcttatccagcaatggtaaat
acggcaaagagtattttggaaaatggaaggtcaaaagaagcatcaattaattgtatgccg
ataaaagaaatattgactttaattccaggaggaatgtag

DBGET integrated database retrieval system