KEGG   Cucumis sativus (cucumber): 101204735Help
Entry
101204735         CDS       T02486                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2
Organism
csv  Cucumis sativus (cucumber)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
6
AA seq 2082 aa AA seqDB search
MGSCDDPAVIGEPFRASVTRLVRCSSQPLPEHQSHQEMASFSSNSREGQMFEPDRGLEVT
TASLCTNASDPDTSGEDGTLRGFEHADSLLMDKRLDGDSGGSDPCLNLDNESCNEGNKTL
SLDMKESEDVDGLVDILGCDATMEMISLTESLVNSVKPEELDNNSCIIDAPAKVERDDTA
QNGPILAGTGTRTDDLKSSYVCEIVSNSASADGLPNDFIQKNELENDGAGCSFSEVADRI
TEASVELEADMLNEMSPLQSGQILPIHVGQSIANYDRYVCRMDGKSLSSTSGETVTVVAD
MNSNPEGCLQMLPSQGCDRIGECLQSDGLPLTINASENDLCEEKHDSNSSSKYVPDVGGD
DSDVLTNNNSDGGQHTVPGIGNDHNLEDATVQVNHDCVELLSSPLPSQLPNSEKDEFYGM
LNGADIPIKYISSVNSCSVGDQDNNDIEKVGCVSEVKCPETVITSSKRSGRRRTSSQKTV
TKRASRKTKKKVPEPLIFDTARRRRSSISRPARPSPWGSLGHIIQSFEEIDDVLVNQTQK
QGNEKSKGNQGGAKRNKKQLSESSHRSRKGTQGKSATSTSTNRIRLKVKLGKNVGHNFLN
IVVPEIVDSSLSAKGVNCNYGNESYWEGNLEFPPSNLGVDDQKAEEEGPLRKIFCYSRNQ
DKEDNCPDASVVNEQCTNNDSSCIVGIDKSSEKHADDNLCVSSHLVDPVATSDARSLDPG
TSPDSEVINSVLDIQVGAARQEILQDSVLASLEDFAASGNAPGSKKGRKKDKPSRVVSCS
EERGISVSACSNRSKSSKKHGRRHNVDNQLSSEIELPEETLKAEDILNDKECCRADVGSV
FSESENSKTFLPSQSAKKKHPKGSKSIKTSKGKSKAPGSKNKIKNASNERVYQRKSFKNS
KSKEALCDQVVTETESHQIIGNCLVDKPEKSDNIIASTVAVDLSVVQGAVNEQYMPPRNA
WVLCDDCHKWRRIPASLVDSLGHASCTWTCKDNVDKAFANCSIPQEKSNAEINAELEISD
ESGEENGSKKRLTYRELESFHPATVNAVPQQNKFASISSNQFLHRSRKTQTIDEIMVCHC
KPALDGRLGCGDECLNRMLNIECVRGTCPCGELCSNQQFQKRKYAKLQWLRCGKKGYGLQ
LLEDISKGQFLIEYVGEVLDMHAYEARQKEYALNGHRHFYFMTLNGSEVIDACGKGNLGR
FINHSCDPNCRTEKWMVNGEICIGLFALRDIKKGEEVTFDYNYVRVFGAAAKKCYCGSFH
CRGYIGGDPLNSEVIIQSDSDEEFPEPVMLRGDGRSLNSNLSTAVSSMDVAKMQSSEHLK
GNRDKRDQPIRIASELKISEEKVDPLKLSASKISEEKEDPLKLSATKISEEKEDPLNLSA
STISPLHSSLEFEDSKVASPIPVPDITHQTEDVTSQPIFVDQTEISLLDNIPDKNTCSIE
QEAKLSVDDIDARKKSKLDSVEDKQVYIKSHPRMKTSRKLGSIKKGKVSSAEKIQITNRS
QISSVKPKRLIEGSPGNRFEAVEEKLNELLDAEGGISKRKDAPKGYLKLLLLTAASGASA
SGEAIQSNRDLSMILDALLKTKSRLVLTDIINKNGLRMLHNIMKQYRSDFKKIPILRKLL
KVLEYLVTREILTSEHINGGPPCPGMESLRESLLSLTEHDDKQVHQIARSFRDRWFPRHT
RKFGYSEREDGRLEVYRGSNSSRFTASHSFRHDQDCRPTDAIDCIKQSMPTSLPDAHPAE
VCSLASAASHSVNGQKVRKRKSRWDQPADTSLDLRSKEQKLESTSVQELNSSQLNSVGAA
SMLIDKVNNDDKDISLSDSVGVPCRQDEDIRADSAVPNIPEDIPPGFSSPFNPPVASSSA
FSAVLDPPRQNIGDLSCAFSTVGHLQERFISRLPVSYGIPFSIIEQCGTSHAENLECWDV
APGVPFHPFPPLPPYPRGMRGLPTSACGTAGQSSQEGQVNSHDSRTSFSEESPPSTSTNY
QTDLCTPSNNQQIAKRAKESSCDLGRRYFRQQKWRNTKFGPPWLQRRSQWGCQGNFRGGV
STIGDENIPDEEISPYCSDEASGRVDKANGDFYQHLQNQNLR
NT seq 6249 nt NT seq  +upstreamnt  +downstreamnt
atgggttcatgtgatgacccggctgtgatcggggaaccgtttcgtgcctctgttactcgg
ctggtcaggtgttcgagtcaacctcttcccgagcatcagtcgcaccaggagatggcttcc
ttttcatctaattctcgtgagggccagatgtttgagccagatagggggctggaagtgact
acggcttctctctgtacgaatgcatcggaccctgatacttctggggaggatgggacgctt
agaggcttcgaacatgcagatagtttgctaatggataaaagattggatggtgattctggc
ggtagtgatccctgtctaaacttggataacgagtcttgcaacgaggggaataaaacattg
agcttggatatgaaagagtctgaagacgttgatggtttggttgatattttgggatgcgat
gctaccatggaaatgatttctttaactgagtcattagtaaattctgtgaaacctgaagaa
cttgataataatagttgtataattgatgctcctgcaaaagttgaaagggatgatactgca
caaaatggtcctattttagcagggacgggtactcgtacagatgacttaaaatcttcttat
gtctgtgaaattgtttctaattcagcttcggctgatggactgccaaatgatttcatacag
aaaaacgagctggaaaatgatggtgctggttgttcattttctgaggttgcagataggata
actgaggcttcggttgaactagaagcagatatgttgaatgagatgtcccctttacagagt
ggtcaaatactaccaatacatgtggggcaatcaattgccaactatgatcggtatgtttgc
cggatggacgggaagagcttaagtagcacctctggagaaacagtaactgtagttgctgat
atgaacagcaaccctgaaggatgcctgcaaatgttgccttcccagggatgcgataggatt
ggggaatgcttgcaatctgatggtttaccactaactattaatgcttcagagaatgatttg
tgtgaggaaaagcatgacagtaattcctcatccaagtacgttccagatgttgggggagat
gatagtgatgtcttgactaacaataatagtgatggtggacaacatacagttccggggatt
ggaaatgaccataatctggaggacgctactgttcaagtgaaccacgactgtgtcgaacta
ctttcatcgcccttgccttctcagctccctaattctgagaaagatgaattttatggaatg
ttgaatggagcagatattccaataaaatatattagttctgttaattcatgtagcgtcggt
gatcaagacaacaatgacatagagaaagttggctgtgtttctgaagttaaatgtcctgaa
acagttatcacgtcttctaagaggagtggccgaaggagaacatcaagccaaaaaactgtg
acaaaaagggcttccaggaaaacaaaaaaaaaggtgccagagccactgatttttgacact
gcaagaaggaggagaagctctatatctagacctgctcgtccctcaccctggggatcactg
ggccatattattcagtcatttgaagaaattgatgatgttctggtaaatcaaacccagaag
caaggaaatgagaaatctaaaggtaatcaaggaggtgccaagcggaataagaaacagcta
agtgaaagttcacatagatcaagaaaagggacccaaggaaaatctgctacttcaacttca
accaaccgtattcgtctgaaggttaaattaggtaaaaacgtgggtcataattttctgaac
attgtggttcccgaaattgttgattcatcattgtctgccaagggtgtcaactgcaattat
ggcaatgaatcatattgggaaggtaatttggaattccctccatcaaaccttggtgttgat
gaccaaaaggccgaggaggaggggcctttaagaaagatcttctgctacagcaggaatcag
gataaagaagataattgtcctgatgcttctgttgtgaatgaacaatgtactaataatgat
tcaagttgcatcgttggtatagacaagtcctctgaaaaacatgcagatgataatctctgt
gtttcctcccatttggttgatcctgtagcgacaagtgatgccaggagtttggatcctgga
acttcgcctgattcagaagtgataaattcagttttagatattcaagtcggagcagcacgt
caggaaattttgcaggactcggttttggcatccttagaagattttgccgcttctggaaat
gctcccggtagtaagaaaggtaggaagaaggacaaaccctctcgggtagttagttgttct
gaggaacgtggcataagtgtttctgcttgcagtaacaggtccaagtcatcaaagaagcac
ggaagaagacataatgtggacaatcaacttagttctgagattgaacttcctgaagagact
ttgaaagcagaagacattctcaatgataaagaatgttgcagagcagatgttggcagtgtg
ttttctgaatcagagaattcaaaaacatttcttccttctcaatccgcaaagaagaaacat
cccaaaggttctaaatctattaaaactagcaaaggcaagtcaaaggctcctggctcaaaa
aacaaaataaagaatgcttcaaatgaaagggtttaccaacggaagtcttttaaaaatagt
aaaagcaaggaggctctatgtgaccaagttgtgactgaaacagaaagtcaccaaatcata
ggaaattgtcttgtcgacaagcctgagaaaagcgataacattattgcatccacggtggca
gtagatttgagtgtggtacagggtgctgtgaatgagcagtatatgcctcctcgcaatgct
tgggtgctctgcgatgactgtcataaatggcgacgcataccagcttctcttgttgatagt
ttaggacatgcaagttgcacatggacttgtaaggacaatgtggataaagcttttgctaat
tgctcaatcccacaagagaagtcgaatgcagagattaatgcagagttggaaatatcagat
gaatctggggaagaaaatggttccaaaaaacggctaacttacagggaattggagagtttt
catccagcaacagtgaatgctgttcctcaacagaacaaatttgcttccattagcagcaat
cagtttttgcaccgcagtcgtaaaacccagactattgatgagataatggtttgtcactgc
aaaccagctttggatggtcggttaggttgtggagatgaatgcttgaaccgaatgctcaat
attgaatgtgtacgaggtacatgtccttgtggggaactttgttctaatcaacagttccag
aagcgtaagtatgctaaattacagtggttgcgatgtggaaagaaaggttatgggctacag
ttgcttgaggatatatcaaaaggacaatttctcattgagtatgttggagaggtccttgac
atgcatgcttatgaggcacgccaaaaggaatatgcattgaatggtcatcggcatttttac
ttcatgaccctaaatggcagcgaggtcatagacgcatgtggaaagggaaatttggggcgt
ttcattaatcacagttgtgatccaaattgccgcacggagaagtggatggtgaatggagaa
atctgcattgggctctttgcactaagggatattaagaagggggaagaggtgacatttgac
tacaattatgtaagggtatttggggctgctgcaaaaaaatgttattgtggttctttccat
tgtcgaggttatataggtggagaccccctcaattctgaggtcattattcaaagtgattca
gatgaagaattccccgaacctgtgatgcttcgaggagatggaagaagtttgaatagtaac
ttgtcaactgcagttagttcaatggatgttgctaaaatgcaatcctctgagcatctaaaa
gggaatagggataagagagatcaacctatcagaattgctagtgaattgaagatttcagaa
gaaaaagtggatcctcttaagctttctgcgtcgaagatttcagaagaaaaagaggatcct
cttaaactttctgcaacgaagatttcagaagaaaaagaagatcctcttaacctttctgcc
tctaccatttctccattgcatagttcattggaattcgaagattcgaaggtagcatcacct
attccagtgccagatattacccatcagactgaggatgtgacaagccaacctatctttgtt
gatcagacagaaatatctcttttggacaatattcctgacaaaaatacatgctctattgag
caggaggcaaagttatcagtggatgacattgacgctcgtaagaagtccaagctggattct
gttgaagataagcaagtgtatataaaatcgcatcctcggatgaaaacttcgcgtaaacta
ggttccatcaagaaaggaaaagttagctctgcagaaaaaatacaaataactaacaggtcc
cagatttcctctgtaaagcccaagcgattgattgaaggttctccgggtaaccgctttgaa
gcagttgaggagaagcttaatgaacttctggatgctgaagggggaattagcaaaagaaaa
gatgcccctaaagggtacttaaagcttcttcttctgactgctgcatcgggtgcaagtgct
agcggtgaagcaattcagagcaatcgggatctttcaatgatccttgatgctcttttgaag
acaaagtcacgattagtattgactgacataataaacaaaaatggtttgcggatgctgcat
aacataatgaagcaatatagaagtgacttcaaaaagatacctattcttcggaagcttttg
aaggtcctggaatacttggtgacaagagagatactcacttcagagcatatcaatggcggt
cccccttgccctggaatggaaagtttgagagagtccttattgtcactgacagagcatgat
gacaaacaggtacatcaaattgcccgaagttttcgggacagatggttcccaagacatact
agaaaatttggttattctgagagagaggatgggagattggaagtttacaggggttcaaac
agcagtaggtttactgcatcacacagttttcggcacgatcaggattgcagacccacagat
gcaattgattgtatcaagcagtcgatgcctacatctttgccagatgctcatcctgcagag
gtctgttctctggcttccgcagctagtcactcagtgaatggacaaaaagtccgtaagcgt
aagagtcgatgggatcagcctgcagatacgagcctagatctgagatctaaggagcagaag
cttgaatcaacatcggtgcaggaattgaattccagccaattaaatagtgttggagcagca
tcaatgctgatagacaaagtaaacaatgatgataaggacatctccctctctgattctgtt
ggagtaccttgtcggcaagatgaagatataagggctgacagtgcagtgccaaacatccct
gaagatattcctcctggattttcatctcccttcaatccccctgttgcttcctcaagtgct
ttttcagcagttttagatcctcctcgacagaatattggcgatttgagttgtgctttttcc
acagttgggcatctacaggaaagatttatttctcgcttgcctgtatcctatggaattcca
ttttctatcattgagcaatgtggaacatctcatgcagagaatctggagtgttgggatgtt
gctcctggagtgccttttcatccttttccacccctaccaccatatccccgaggtatgaga
ggcctgcctacatctgcctgtggtactgctggacaatcgtctcaggaagggcaggtgaac
agccatgattctcgaacttctttctcagaagaaagccctcctagtacaagtactaattac
caaacagatttgtgcactccatcaaacaaccagcagatagcgaaacgggcaaaagaatca
tcatgtgacttgggacgaagatactttaggcagcagaagtggcgtaatacaaagtttggc
cccccttggttacagagaagaagtcagtggggatgccaggggaacttcaggggtggggtg
agcactataggtgatgaaaatattcccgacgaggaaataagtccatattgctcggatgaa
gcaagcggtagagtggataaagctaatggtgatttttatcagcatttgcagaaccaaaat
ctgcgttag

DBGET integrated database retrieval system