KEGG   Cucumis sativus (cucumber): 101219300Help
Entry
101219300         CDS       T02486                                 

Gene name
RBCS, ruBisCO
Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101219300 (RBCS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101219300 (RBCS)
Enzymes [BR:csv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     101219300 (RBCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5
AA seq 185 aa AA seqDB search
MASSILSSAAVASVNSASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNGGKVQCM
KVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGY
YDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKPP
RFYSS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatccattctctcatccgccgctgttgcctctgtgaacagtgcttcccctgct
caagctagcatggtagcaccattcactggcctcaaatcttccgctggtttccccatcact
cgcaagaacaacgtcgacatcaccactttggctagcaatggtggaaaagttcagtgcatg
aaggtgtggccaccacttggattgaggaagttcgagactctttcttacctgcctgatatg
agtaacgaacaattgtcaaaggaatgtgactaccttctcaggaatggatgggttccctgc
gttgaattcgacatcggaagcggattcgtgtaccgtgagaaccacaggtcaccaggatac
tacgatggacgttactggaccatgtggaagctccctatgtttggctgcaccgactcatct
caggtgattcaggagattgaggaggctaagaaggaataccccgacgcattcatcagggtt
attggctttgacaacgtccgtcaagtgcagtgcatcagtttcatcgcctacaagccccca
agattctactcttcttaa

DBGET integrated database retrieval system