KEGG   Cucumis sativus (cucumber): 101219300Help
Entry
101219300         CDS       T02486                                 

Gene name
RBCS, ruBisCO
Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00630  Glyoxylate and dicarboxylate metabolism
csv00710  Carbon fixation in photosynthetic organisms
csv01100  Metabolic pathways
csv01200  Carbon metabolism
Module
csv_M00165  Reductive pentose phosphate cycle (Calvin cycle)
csv_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
csv_M00532  Photorespiration
csv_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101219300 (RBCS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101219300 (RBCS)
Enzymes [BR:csv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     101219300 (RBCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 101219300
NCBI-ProteinID: XP_004135094
UniProt: A0A0A0KR46
LinkDB All DBs
Position
5
AA seq 185 aa AA seqDB search
MASSILSSAAVASVNSASPAQASMVAPFTGLKSSAGFPITRKNNVDITTLASNGGKVQCM
KVWPPLGLRKFETLSYLPDMSNEQLSKECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGY
YDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKPP
RFYSS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatccattctctcatccgccgctgttgcctctgtgaacagtgcttcccctgct
caagctagcatggtagcaccattcactggcctcaaatcttccgctggtttccccatcact
cgcaagaacaacgtcgacatcaccactttggctagcaatggtggaaaagttcagtgcatg
aaggtgtggccaccacttggattgaggaagttcgagactctttcttacctgcctgatatg
agtaacgaacaattgtcaaaggaatgtgactaccttctcaggaatggatgggttccctgc
gttgaattcgacatcggaagcggattcgtgtaccgtgagaaccacaggtcaccaggatac
tacgatggacgttactggaccatgtggaagctccctatgtttggctgcaccgactcatct
caggtgattcaggagattgaggaggctaagaaggaataccccgacgcattcatcagggtt
attggctttgacaacgtccgtcaagtgcagtgcatcagtttcatcgcctacaagccccca
agattctactcttcttaa

DBGET integrated database retrieval system