Carlito syrichta (Philippine tarsier): 103252103 Help Entry 103252103         CDS       T07836                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism csyr  Carlito syrichta (Philippine tarsier) Pathway csyr01523   Antifolate resistance csyr04010   MAPK signaling pathway csyr04014   Ras signaling pathway csyr04024   cAMP signaling pathway csyr04062   Chemokine signaling pathway csyr04064   NF-kappa B signaling pathway csyr04066   HIF-1 signaling pathway csyr04071   Sphingolipid signaling pathway csyr04137   Mitophagy - animal csyr04151   PI3K-Akt signaling pathway csyr04210   Apoptosis csyr04211   Longevity regulating pathway csyr04218   Cellular senescence csyr04380   Osteoclast differentiation csyr04613   Neutrophil extracellular trap formation csyr04620   Toll-like receptor signaling pathway csyr04621   NOD-like receptor signaling pathway csyr04622   RIG-I-like receptor signaling pathway csyr04623   Cytosolic DNA-sensing pathway csyr04625   C-type lectin receptor signaling pathway csyr04657   IL-17 signaling pathway csyr04658   Th1 and Th2 cell differentiation csyr04659   Th17 cell differentiation csyr04660   T cell receptor signaling pathway csyr04662   B cell receptor signaling pathway csyr04668   TNF signaling pathway csyr04722   Neurotrophin signaling pathway csyr04917   Prolactin signaling pathway csyr04920   Adipocytokine signaling pathway csyr04926   Relaxin signaling pathway csyr04931   Insulin resistance csyr04932   Non-alcoholic fatty liver disease csyr04933   AGE-RAGE signaling pathway in diabetic complications csyr04936   Alcoholic liver disease csyr05010   Alzheimer disease csyr05022   Pathways of neurodegeneration - multiple diseases csyr05030   Cocaine addiction csyr05132   Salmonella infection csyr05133   Pertussis csyr05134   Legionellosis csyr05135   Yersinia infection csyr05140   Leishmaniasis csyr05142   Chagas disease csyr05145   Toxoplasmosis csyr05146   Amoebiasis csyr05152   Tuberculosis csyr05160   Hepatitis C csyr05161   Hepatitis B csyr05162   Measles csyr05163   Human cytomegalovirus infection csyr05164   Influenza A csyr05165   Human papillomavirus infection csyr05166   Human T-cell leukemia virus 1 infection csyr05167   Kaposi sarcoma-associated herpesvirus infection csyr05168   Herpes simplex virus 1 infection csyr05169   Epstein-Barr virus infection csyr05170   Human immunodeficiency virus 1 infection csyr05171   Coronavirus disease - COVID-19 csyr05200   Pathways in cancer csyr05202   Transcriptional misregulation in cancer csyr05203   Viral carcinogenesis csyr05207   Chemical carcinogenesis - receptor activation csyr05208   Chemical carcinogenesis - reactive oxygen species csyr05212   Pancreatic cancer csyr05215   Prostate cancer csyr05220   Chronic myeloid leukemia csyr05221   Acute myeloid leukemia csyr05222   Small cell lung cancer csyr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer csyr05321   Inflammatory bowel disease csyr05415   Diabetic cardiomyopathy csyr05417   Lipid and atherosclerosis csyr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csyr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103252103 (RELA)    04014 Ras signaling pathway     103252103 (RELA)    04064 NF-kappa B signaling pathway     103252103 (RELA)    04668 TNF signaling pathway     103252103 (RELA)    04066 HIF-1 signaling pathway     103252103 (RELA)    04071 Sphingolipid signaling pathway     103252103 (RELA)    04024 cAMP signaling pathway     103252103 (RELA)    04151 PI3K-Akt signaling pathway     103252103 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     103252103 (RELA)   09143 Cell growth and death    04210 Apoptosis     103252103 (RELA)    04218 Cellular senescence     103252103 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103252103 (RELA)    04620 Toll-like receptor signaling pathway     103252103 (RELA)    04621 NOD-like receptor signaling pathway     103252103 (RELA)    04622 RIG-I-like receptor signaling pathway     103252103 (RELA)    04623 Cytosolic DNA-sensing pathway     103252103 (RELA)    04625 C-type lectin receptor signaling pathway     103252103 (RELA)    04660 T cell receptor signaling pathway     103252103 (RELA)    04658 Th1 and Th2 cell differentiation     103252103 (RELA)    04659 Th17 cell differentiation     103252103 (RELA)    04657 IL-17 signaling pathway     103252103 (RELA)    04662 B cell receptor signaling pathway     103252103 (RELA)    04062 Chemokine signaling pathway     103252103 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     103252103 (RELA)    04917 Prolactin signaling pathway     103252103 (RELA)    04926 Relaxin signaling pathway     103252103 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     103252103 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     103252103 (RELA)   09149 Aging    04211 Longevity regulating pathway     103252103 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103252103 (RELA)    05202 Transcriptional misregulation in cancer     103252103 (RELA)    05207 Chemical carcinogenesis - receptor activation     103252103 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     103252103 (RELA)    05203 Viral carcinogenesis     103252103 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103252103 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     103252103 (RELA)    05221 Acute myeloid leukemia     103252103 (RELA)    05220 Chronic myeloid leukemia     103252103 (RELA)    05215 Prostate cancer     103252103 (RELA)    05222 Small cell lung cancer     103252103 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103252103 (RELA)    05170 Human immunodeficiency virus 1 infection     103252103 (RELA)    05161 Hepatitis B     103252103 (RELA)    05160 Hepatitis C     103252103 (RELA)    05171 Coronavirus disease - COVID-19     103252103 (RELA)    05164 Influenza A     103252103 (RELA)    05162 Measles     103252103 (RELA)    05168 Herpes simplex virus 1 infection     103252103 (RELA)    05163 Human cytomegalovirus infection     103252103 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     103252103 (RELA)    05169 Epstein-Barr virus infection     103252103 (RELA)    05165 Human papillomavirus infection     103252103 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     103252103 (RELA)    05135 Yersinia infection     103252103 (RELA)    05133 Pertussis     103252103 (RELA)    05134 Legionellosis     103252103 (RELA)    05152 Tuberculosis     103252103 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     103252103 (RELA)    05145 Toxoplasmosis     103252103 (RELA)    05140 Leishmaniasis     103252103 (RELA)    05142 Chagas disease     103252103 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     103252103 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     103252103 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     103252103 (RELA)   09165 Substance dependence    05030 Cocaine addiction     103252103 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103252103 (RELA)    05418 Fluid shear stress and atherosclerosis     103252103 (RELA)    05415 Diabetic cardiomyopathy     103252103 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103252103 (RELA)    04932 Non-alcoholic fatty liver disease     103252103 (RELA)    04931 Insulin resistance     103252103 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     103252103 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     103252103 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:csyr03000]     103252103 (RELA) Transcription factors [BR:csyr03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     103252103 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  103252103 NCBI-ProteinID:  XP_021564615 Ensembl:  ENSTSYG00000031688 UniProt:  A0A3Q0DRH1 LinkDB All DBs Position Unknown AA seq 579 aa AA seqDB search FPGKFWGAGPASVSPGEGPGSLLSVGSVPGEDGRWTRADSCLPPLSDLFPLIFPSEPAQA SGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISL VTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQT NNNPFQVPVEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLQPVLSHPIFDNRAPNTAELKI CRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPP YADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKS PFSGPTDPRPPPRRIAVPARGSAAIPKPAPQPYPFTPSLSTINYEEFSPVVFHPGQIPSQ APALAPAPAPVLAPVPAPAPTPXXXXXXXXXXXKPSQAGEGTLTEALLQLQFDAEDDLGA LLGNSTDPAVFTDLASVDNSEFQQLLNQGVPMASHTAEPMLMEYPEAITRLVTGSQRPPD PAPNPLGASGLANGLLSGDEDFSSIADMDFSALLSQISS NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt tttcctggcaagttctggggagcaggccctgcctcagtttccccgggagagggtccgggt tctctcctctccgtggggagtgtccctggtgaggatggaaggtggactcgtgctgactcg tgtctccctccgctttcagatctgttcccgctcatcttcccctccgagccagcccaggcc tccggcccctatgtggaaatcatcgagcagcccaagcagcggggcatgcgcttccgctac aagtgcgaggggcgctcggcgggcagcatcccgggggagaggagcacggacaccaccaag acccaccccaccatcaagatcaatggctacacaggaccaggaactgttcgcatctccctg gtcaccaaggaccccccgcaccggcctcacccacacgagcttgtggggaaggactgcagg gatggcttctatgaggccgagctctgcccagaccgctgcatccacagtttccagaacctg gggatccagtgtgtgaagaagcgggacctggaacaggccatcagtcagcgcatccagacc aacaacaaccccttccaagttcccgtagaagagcagcgtggcgactacgacctgaacgcc gtgcggctctgcttccaggtgacagtgcgtgacccatcgggcaggcccctccgcctgcag ccggtcctctctcaccccatctttgacaaccgtgcccccaacactgctgagctcaagatc tgccgagtgaaccgcaactccgggagctgcctcggtggggatgagatcttcctgctgtgt gacaaggtgcagaaagaggacattgaggtgtatttcacgggaccaggctgggaggcccga ggctccttctcacaagcggatgtgcaccgacaagtggccattgtgttccggacccctccc tatgcggaccccagcctgcaggctcccgtgcgcgtctccatgcagctgcggcggccttct gaccgggagctcagcgagcccatggagttccagtacctgccagacacagatgaccggcac cggattgaggagaaacgcaagaggacatacgagaccttcaagagcatcatgaaaaagagt cctttcagtggacccaccgatccccgccctccaccccggcgcattgctgtgcctgcccgc ggctcagctgccatccccaagccagctccccagccctaccccttcacgccatccctcagc accatcaactatgaagagttctcccccgtggtgtttcatcctgggcagatcccaagccag gcccccgccttggcaccagcccctgccccagtcctggccccggtcccggcccccgccccc accccnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnaagccctcccaggccggggag gggacactgacggaggccctgctgcagctgcagttcgatgccgaggacgacctgggggcc ttgcttggcaacagcacagacccagctgtgttcacagacctggcatctgtcgacaactct gagttccagcagctgctgaaccagggtgtacctatggcctcccacacagctgagcccatg ctgatggaataccctgaggctataacccgcctggtgacagggtcccagaggccccctgac ccagctcccaaccccctgggggcctcggggctcgccaatggcctcctctcaggtgatgaa gacttctcctccatcgctgacatggacttctcagcccttctgagtcagatcagctcgtaa

DBGET integrated database retrieval system