KEGG   Cronobacter sakazakii Sp291: CSSP291_17150Help
Entry
CSSP291_17150     CDS       T02461                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
csz  Cronobacter sakazakii Sp291
Brite
Translation factors [BR:csz03012]
 Eukaryotic Type
  Elongation factors
   CSSP291_17150
 Prokaryotic Type
   CSSP291_17150
Mitochondrial biogenesis [BR:csz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CSSP291_17150
Exosome [BR:csz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CSSP291_17150
  Exosomal proteins of breast cancer cells
   CSSP291_17150
  Exosomal proteins of colorectal cancer cells
   CSSP291_17150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3644091..3645275)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGHLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgccatcactaccgttctggcgaaaacctac
ggtggttctgctcgtgcattcgaccagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgaatatgacaccccgactcgccactacgcgcacgtt
gactgcccgggccacgccgactacgtgaaaaacatgatcaccggtgctgctcagatggac
ggtgctatcctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgacttcccgggcgacgacaccccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgctgagtgggaagcgaaaatcatcgaactggctggtcacctggattcctacatc
ccggaaccggagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctctggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaggttggt
gaagaagttgaaatcgtgggcatcaaagacaccgcgaaatccacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgcgggcgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggctccatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagatgaaggcggccgtcac
actccgttcttcaaaggctaccgtccgcagttctacttccgtacgactgacgtgactggc
accatcgaactgccggaaggcgtggagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgatggtctgcgtttcgcaatccgcgaaggc
ggtcgtaccgttggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system