KEGG   Clostridium tetani E88: CTC_02513Help
Entry
CTC_02513         CDS       T00112                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ctc  Clostridium tetani E88
Pathway
ctc00473  D-Alanine metabolism
ctc01100  Metabolic pathways
ctc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ctc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CTC_02513
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CTC_02513
Enzymes [BR:ctc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CTC_02513
Peptidoglycan biosynthesis and degradation proteins [BR:ctc01011]
 Precursor biosynthesis
  Racemase
   CTC_02513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AAO36974
UniProt: Q890X1
LinkDB All DBs
Position
complement(2670505..2671668)
Genome map
AA seq 387 aa AA seqDB search
MFKHLRPVWAEIDLDKLVYNMQQIKNICKGREIIAVVKADAYGHGALDIAPILLENGATR
LAVAVLNEAIELRRGGIDAPIMVLGFTPDSLIETSLKYNIEQTVYSYEIAKEISEVAVKS
NRVAKIHIALDTGMGRIGFLPDKESIDKIYKLSKLPNIQIEGIFSHFASADEQDKTYTKL
QFNKFLWVCNSLEERGIDIKIRHIANSAAIIDMPELHLEGVRPGIIMYGYYPSSEVNKGK
LDLKPVMSLKTTIVHIKNMEKGKYISYGREFKTEKESIIATLPVGYADGYSRSLYDKGGK
IILKEQLAPLVGRICMDQCMIDVSHIEDVKIGDEVILMGENKGIKMTAEEIGNLLGTINY
EVTCMISKRVPRVYIRDGNIVGIRNYV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacatttaagacctgtatgggcagaaatagatttagataaattagtttataat
atgcaacaaattaaaaatatatgtaaaggtagagaaattatagcagtagttaaagctgat
gcttatggtcatggagcattagatattgccccaattctattagaaaatggagctactaga
ttagcagttgcagtattaaatgaagcaatagaacttagaagaggtggaatagatgcacct
ataatggtgctaggatttacccctgatagtttaattgaaacttctttgaaatataatata
gagcaaactgtatatagctatgaaatagcaaaggaaatatctgaagttgctgtgaaatct
aatagagtagctaaaattcatatagctttggatacaggcatgggtagaataggattttta
ccagataaagaaagcatagataaaatttataaattaagtaaattgcctaatatacagata
gagggaatattctctcactttgcctccgctgatgaacaagataaaacttatactaaacta
caatttaataaatttctttgggtttgtaatagtttagaagaaagggggatagacataaaa
ataagacatattgcaaatagtgctgccattatagatatgccagaattacacctagaaggg
gtaagaccaggtatcataatgtatggatattatccatctagtgaagttaataagggaaaa
ttggacttaaaaccagttatgtctttaaaaactactatagttcatattaaaaatatggaa
aaagggaagtatataagttatggaagagaatttaaaacagaaaaggaaagtataatagcc
accttaccagtaggatatgctgatggatatagtagatccttatatgataagggaggaaaa
attatattaaaagaacaattagctccattagtaggaagaatatgcatggatcaatgtatg
atagatgtaagccacatagaagatgtgaaaataggagatgaagtaattcttatgggagag
aataaaggtataaaaatgacggcagaagaaataggaaatttattaggaacaattaattac
gaagtaacctgcatgataagtaagagggtacctagggtatatatacgagatggaaatata
gttggaataagaaattatgtataa

DBGET integrated database retrieval system