KEGG   Corynebacterium testudinoris: CTEST_07090Help
Entry
CTEST_07090       CDS       T03956                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cted  Corynebacterium testudinoris
Pathway
cted00620  Pyruvate metabolism
cted00680  Methane metabolism
cted01100  Metabolic pathways
cted01120  Microbial metabolism in diverse environments
cted01200  Carbon metabolism
Module
cted_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cted00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CTEST_07090 (ppc)
  Energy metabolism
   00680 Methane metabolism
    CTEST_07090 (ppc)
Enzymes [BR:cted01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CTEST_07090 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKK08855
UniProt: A0A0G3H7X0
LinkDB All DBs
Position
complement(1457471..1460242)
Genome map
AA seq 923 aa AA seqDB search
MRVTARNHLQEDIRYLGRILGQVIAEQEGDEVFNLVELARQQAFEVAKGNADLEVLVELF
RNIEPTQATRVIRAFSHFALMANLAEDIHDDVNRERQLDAGGPALDSTLDATWDKLASAE
LESADIARILDGALVAPVLTAHPTETRRRTVFDAQKHITELLIQRNAVLEAELNARTEAR
LASIDNDIRRRMTILWQTALIRVARPRIEDEIEVGLRYYKLSLLKEIPALNRAVNQRLKA
DFGDVTPARPILRPGSWIGGDHDGNPYVTAETLDYASRRAAQTVLKYYAAQLHALEHELS
LSDRMTGVTVELVALAKEGNNEVPSRVDEPYRRAVHGVRGRILATTATLVGEDAVEGVWH
RQYAPYTSAEEFDADLATIDVSLRSSQDDIIADDRLASIRSAIASFGFHLYSIDLRQNSE
SFENVLTEVFATAHVTEDYAALSEDAKVELLTTELRTPRPLVPRGYRGFSEPTQRELDLI
AQASDSVERFGEKMVPHQIISMATSVSDILEPMVLLKEAGLIRADGDTPTGSIDIIPLFE
TIDDLEAGADILRQLWDLPLYRSYLTQRGGIQEIMLGYSDSNKDGGYFAANWALYAAELE
LVEISREYGIRLRLFHGRGGTVGRGGGPSYDAILAQPKGAVDGSVRVTEQGEIISAKYGS
PRAARRNLEALVSATLEASLLPVDELEDRERAIEIMTEISRLSRDKYASLIHEDPGFIPY
FVQSTPLAEIGALNIGSRPTARKQTKAVDDLRAIPWVLAWSQSRVLLPGWFGVGTALAEW
IGEGEGSEERRAELRRLYETWPFFTSVMSNMAQVMSKAGMELAELYARLVDDREIASRVH
AVIVEEFELTRRMFSEVTGSDDLLADNPSLARSVRRRFPYLLPLNIIQLELLRRHRAGDE
RDAVSRGIQLTMNGLATALRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgactgcacgcaatcacctacaggaagatattagatacctgggccgtattctc
ggccaggtgattgcggagcaggaaggcgacgaggttttcaacctggtcgaactagcccgc
caacaggccttcgaggtggcaaagggaaatgccgacctcgaggtcttggtggagctgttc
cgcaatatcgaacccacgcaagcgacgcgcgtcatccgtgcgttttcccacttcgcgctc
atggcgaatctcgcggaggacatccacgatgatgtcaaccgggaacgccaactcgatgcg
ggaggccccgctctcgactccacgttggacgcgacctgggacaagctcgcctcggccgag
ctcgagtccgccgacatcgcccgcatcctcgacggggctctcgtcgcacccgtcctcaca
gctcacccgacggaaacccgccgtcgcaccgtgttcgacgcccagaagcacatcaccgag
ttgttgattcaacgcaacgctgtcctcgaagccgagctcaatgctcgaactgaggcgcgc
ttggcgtccatcgataacgacattcgtcgacgcatgaccattctctggcaaacggcactt
atccgggtggctcgcccccggattgaagacgaaatcgaagttggcctgcgctactacaag
ctctctttgctcaaagagatcccggctcttaaccgagccgtcaaccagcggctcaaggca
gacttcggcgacgtcacccctgcccgacccattcttcgtcccggttcgtggatcggcggc
gaccacgacggtaacccctatgtcaccgccgagaccttggattacgcctcccgccgcgcc
gcgcagactgtactgaagtactacgccgcccagctgcatgcgttggagcatgagctcagc
ctgtcggaccggatgaccggtgtgacagtcgagctcgtcgcactggctaaggaaggcaat
aacgaggttcccagccgagttgatgaaccgtatcggcgcgccgtccatggcgtgcggggt
cggatcttggccaccacggcgacactggtgggcgaggatgctgtcgaaggcgtgtggcac
cgccaatacgcgccctacacctcggcggaggagttcgacgccgaccttgccaccatcgat
gtgtcgctgcgtagttcgcaggacgacatcattgccgacgaccgcctggcctccatccgc
tcggccatcgccagcttcgggttccacctgtattccatcgatttgcggcagaactcggag
agctttgagaatgtcctcaccgaggtgtttgccaccgcgcacgtcactgaggactacgcg
gccctgtcagaggacgccaaggtcgaactgctgaccacggagctgcggaccccgcgccca
ttggttccccgcggataccgtggatttagcgaaccgacgcaacgggagctggatctcatc
gcccaggcgtccgactccgtcgagcgcttcggcgagaagatggttccgcaccagatcatc
tccatggcgacgtcggtcagtgacattctcgagccgatggtgctgctgaaagaagccggt
ctcatccgggccgatggggataccccaacgggcagcattgacatcatcccattgttcgag
accatcgatgacctcgaagctggtgctgatatcctgcgccagctgtgggacttgcctctc
taccgctcctacctcacccaacgcggcgggattcaggagatcatgctcggctactccgac
tccaacaaggatggcggctatttcgccgctaactgggcgctctacgccgccgaattggag
ctggtggagatttcccgcgagtacggcatccgcttgcgtcttttccatggccgcggcgga
accgtcggccgcggtggcggaccctcctatgacgccatcctcgcgcagccaaagggcgct
gttgatggttcggttcgggtgactgaacagggtgagatcatctccgcgaagtacggcagc
ccccgagctgcgcggcgcaatttggaagctttggtctcggcgactttggaggcgagcctc
ttgcccgtggatgagctcgaagatcgcgagcgggcgattgagatcatgacggagatttcc
cgcttgagccgcgacaagtacgcctccctcatccacgaggaccctggcttcattccctac
ttcgtgcagtccaccccattggcggagatcggggctctcaacatcggttcccgccccacg
gcacgcaagcaaaccaaggccgtcgatgacctgcgtgccatcccttgggtgcttgcctgg
tcacagtctcgagtcctgctgcccggttggtttggcgtgggcaccgctctggcggaatgg
atcggggagggtgagggctcggaggagcgccgagccgagctgcgccgtctctacgagacg
tggccatttttcacctccgtgatgtccaacatggcacaggtgatgagtaaggcaggcatg
gaattggctgagctctacgcccggcttgtcgacgaccgcgagatcgcctcccgcgtccac
gccgtcatcgtcgaggaattcgaactcactcgccgcatgttcagcgaagtaaccgggagc
gacgatctcttggcggataacccgtcattggctcgctcggtgcgtcgccgcttcccctac
ctcttgccgctgaacatcatccaattggagttgctgcgcaggcaccgcgccggcgacgaa
cgtgacgccgtgtcacggggaatccagttgaccatgaacgggctcgcgacggcgctaagg
aattcgggctaa

DBGET integrated database retrieval system