KEGG   Corynebacterium testudinoris: CTEST_12930Help
Entry
CTEST_12930       CDS       T03956                                 

Gene name
nanI
Definition
(GenBank) Concanavalin A-like lectin/glucanases superfamily/BNR repeat-like domain
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cted  Corynebacterium testudinoris
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cted00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CTEST_12930 (nanI)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CTEST_12930 (nanI)
Enzymes [BR:cted01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CTEST_12930 (nanI)
Bacterial toxins [BR:cted02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CTEST_12930 (nanI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2676599..2678590)
Genome map
AA seq 663 aa AA seqDB search
MTRTILCDFRSTVADSPLLHSPALTLELRRGALYLTAPGVILDMEDTANLADGIWHSLGI
VTGESGTRIFVDGYQCFSATADLSNIDDLYPAPAVRGLETIEGELPETEILARAVHPVPL
IEFAAAELDAFDVAEVVELRTGTIVLRFRVRGPGQYGTVLAAAGDGEERLTVLIDAAGIH
YRTLTHRGTWRDFTLPGRFDDGEWIDLAITVTGGAVDIYHSGYLDAHLPGRAFFADTAGL
DRIVVGQDTKGERLWGEVRDAAIFPVPLNGAQLKRLSGVAPIHTRCLFDSGYDGAVSYRI
PSLLTTASGVVIAGADQRETIPNDAPNAVNFVVRRSLDGGDTWGSMSTVVSWPGEGLLGA
SATDSCLVQDRTSGRVIALLDHFPGGIGQPNAAEGVGVDKQGRYVLSDGTVDADPPPEAF
LAAEVAPEGQALTARTSYVQMVFSDDDGATWSQPMNLNQQLKDESMIFLGVAPGCGIQLA
SGRLLIPMYFNTTANRAHFRCAVAYSDDGGHTWTLGSAPRGETATYESTIVERADGSVLM
LMRNQAEIGRVAAAVSEDGGETFGEITFLDDVPEIFSQPNAIRLGDALVFANASQLLPYR
GRGVLRLSRDDGATWPIARTFNPKHYVYQCMTQLPDGTLGLLWERETQGLYFTRVPLQWF
PAD
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcacgatcctctgtgattttcgcagcaccgtcgccgacagccccctcctccac
tcccccgcactcaccctcgaactccgccgcggcgccctctacctcaccgcgccgggcgtc
attctggacatggaagataccgccaacctcgccgacggtatctggcacagcctgggcatt
gtcaccggcgaatcgggcacccgcatcttcgtcgatggctaccagtgcttctccgccacc
gccgatctcagcaacatcgatgacctctaccccgccccggccgtccgcggcctcgagacg
atcgagggcgaactcccagagaccgagatcctcgcccgcgccgtccaccccgtccccctc
atcgaattcgcggcggcggagctcgatgctttcgacgtcgccgaggtcgtcgagctgcgc
acgggcaccatcgtcctgcgcttccgcgtccgcggcccgggccaatatggcaccgtgttg
gccgccgccggagacggcgaggagcgtcttactgtgcttatcgacgccgccggcatccac
taccgcaccctcactcaccgtggcacctggcgggatttcaccctcccggggcggttcgac
gatggcgagtggatcgacctggccatcaccgtcaccggcggggccgtcgacatttatcat
tccggctacctcgacgcccatctgccgggccgggcctttttcgccgacaccgcggggctg
gaccggatcgtggtcgggcaggatacgaaaggcgagcggctgtggggtgaggtccgcgac
gccgccattttcccggttcccctcaatggcgcccagctcaagcggctcagcggcgtcgcg
ccgatccacactcgctgcctcttcgactctggctacgacggtgccgtcagttaccgcatc
ccctcgctgctcacgaccgcctctggcgtcgtcatcgcgggggctgaccagcgggaaacc
atccccaatgatgcccccaacgccgttaacttcgtcgtgcgccgttccctcgacggcggt
gacacgtgggggtcgatgagcaccgttgtgtcttggccgggcgagggcctgctcggggcg
tctgcgactgattcctgcctcgtgcaggatcggacttctgggcgagtcatcgccctcctt
gaccacttcccgggtgggattgggcagccgaacgctgcggaaggggtgggcgtcgataag
caaggacgatatgtgctttctgatggcaccgtcgatgccgacccgcccccggaggcattt
cttgcggcggaggtcgcgccggaggggcaggcgctgaccgcgcgcacctcctacgtgcag
atggtgttttctgacgacgatggcgccacctggtcccagccgatgaacctcaaccagcag
ctcaaggacgaatcgatgatcttcctcggggtggcgcccggctgcggcattcaactcgcc
agcggccggctgctcatcccgatgtacttcaacaccaccgccaaccgagcccatttccgg
tgcgcagtggcctattccgacgacggcggacacacctggacgctgggctcagccccgcgg
ggcgagaccgccacctacgaatccaccatcgtcgagcgggcggacggctccgtgctcatg
cttatgcgcaaccaagctgagatcggccgggtggctgccgccgtcagtgaggatggtggc
gagacgtttggggagatcacctttcttgatgatgtgccggagatcttctcccaacccaat
gcgatccgcctcggcgacgcactcgtcttcgccaatgcctcccagctcctcccctaccgc
gggcgcggagtgctgcggctgagcagggacgacggtgcgacgtggcccatcgcgcggacc
ttcaacccgaagcattacgtctatcaatgcatgacccagctgcccgatggcaccctcggc
ctcctgtgggaacgcgagacccagggcctctacttcacccgcgtgccgctgcaatggttc
cccgccgactag

DBGET integrated database retrieval system