KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_2697Help
Entry
Cthe_2697         CDS       T00474                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cthe_2697
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Cthe_2697
Enzymes [BR:cth01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Cthe_2697
Peptidoglycan biosynthesis and degradation proteins [BR:cth01011]
 Precursor biosynthesis
  Racemase
   Cthe_2697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3183182..3184357
Genome map
AA seq 391 aa AA seqDB search
MGMDYKFNRAWAEVNLDNIAHNVKEIRRIVDKKVEIMGVVKADAYGHGVMEIARTLLENG
VTRLAVSMLDEAIQLRQNGIKVPILILSYTDPVRAEEIVLNDVTQTVFSHDLAEALSEAA
VKHHRNVKIHIKIDTGMTRVGFMPGYSAVKNVVQISKLPGIIIEGLFTHFASADEADKSY
TYMQFERFMSIVGELNRIGVYIPVKHVCNSAALIEFPEMHLNMVRPGIALYGLYPSDEVD
KTKIDLRPAMSLKANVILVKDVEKDTFISYGRIFKTSRNSRIATIPIGYADGYTRLLTGK
GKVLLNGQLAPIVGRICMDQCMVDITDIEGDVKVGDEAVLIGKQKDNEIKVEDLAKSVGT
INYELVSIIGKRIPRVYLKEGKIYNVLNYLI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggaatggactataaatttaacagggcatgggccgaggttaatctggacaacattgcc
cataatgtaaaggaaatcaggcgaattgttgacaagaaagttgagataatgggagtggtt
aaggctgacgcatacggacatggagtaatggagattgccagaacacttttggaaaacggt
gttacccgtctggcggtgtccatgctggatgaagccatacagcttcgtcaaaacggtatt
aaggttccgatattgatattaagctataccgaccctgtacgggcggaagagattgtttta
aacgacgtcacccagacggttttcagccatgatttggcggaagctctgtcggaggcggct
gtaaaacaccacagaaatgtaaagattcatatcaagatagataccggtatgacaagggtt
ggatttatgcccggttacagtgcggttaagaatgtggtgcagataagcaagctgccgggc
attattattgaaggattgtttacccattttgcatcggcggacgaggctgacaaatcctac
acctatatgcagtttgaaaggtttatgagcatagtcggcgaacttaacagaataggggtg
tatattcccgtaaagcacgtatgcaacagtgccgcgttgattgagtttcctgaaatgcac
ctcaacatggtaaggccgggtatagcattgtacggattgtatccttcggatgaggtggat
aaaaccaaaatcgacttaagaccggccatgtctttaaaggcaaatgtgatacttgtaaaa
gatgtggaaaaggacacctttatcagctacggaagaatatttaaaacgagccggaacagc
aggatagcaactatacccataggatatgccgacggatatacaaggcttcttaccggcaaa
ggaaaagtacttctgaacggtcagctggctcctattgtgggaagaatttgcatggatcag
tgcatggtagacataacggatattgaaggagacgtaaaagtcggagatgaagccgtgctt
atcggaaagcagaaagataacgaaataaaagtcgaggacctggcaaaaagtgttgggaca
ataaattacgaactggtaagcataataggaaagagaattcccagagtttacctgaaagaa
gggaagatatacaatgtattaaattatttgatataa

DBGET integrated database retrieval system