KEGG   Chroococcidiopsis thermalis: Chro_0852Help
Entry
Chro_0852         CDS       T02360                                 

Definition
(GenBank) Glutathione S-transferase domain protein
Organism
cthe  Chroococcidiopsis thermalis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
967985..969082
Genome map
AA seq 365 aa AA seqDB search
MAEITIYSATVCPYAHRSRLVLLEKGIDFELIEIDLQNKPAGFTEISPYGKVPVIKHGDV
RVWESAIINEYLDEVFPEPSLLPKEPVNRAQARIWIDFANTRFIWAYSNLLRSPDPQQQK
AAAQELYSQLEFIEKEGLEKLSGEGSYWFGNSISLVDLTFYPWFERWSALEHYRGFGLPP
EFTRLQQWRKAVSQRESVKAIANPTEYYIQRYARFAAPIAKKVSDELSVAGKLTLEQLQQ
AAQQGFKSVLNLRSPDEPGFLSDEQQQAQAAGLDYANIPLQSSEPDLISTKEAIRATENL
PKPILIHCAAGARAGGIALIATAIQQGLTYEQIQEKAQQVDLDLNQPHLQQFLLENYTAK
QETES
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatcacaatttacagtgccacagtttgtccttacgctcatcgctcgcgccta
gttttactagagaaaggaattgacttcgagctgattgaaatcgatctacaaaataagcca
gcgggatttacagagatctcaccctacggcaaagttccggtaatcaagcatggggatgtg
cgggtttgggaatcggcaattattaatgaatatctcgatgaagtatttccagaaccgtca
ctgttgccaaaagagcctgtaaatagagcgcaagccagaatttggattgattttgctaat
actcggtttatctgggcttattccaatcttctacgttctccagatccgcaacaacaaaag
gcagcggcacaggagttatacagtcagctagaatttattgaaaaagagggtttagaaaaa
ctatctggagaaggatcgtattggtttggtaattctattagtttagtcgatctcaccttc
tatccttggtttgaaagatggtcggcgctcgaacattatcgcggttttgggctaccacct
gaattcacgcggttgcagcaatggcggaaagcagtaagtcaacgcgaatctgtgaaggcg
atcgccaatccaacagaatactatattcagcgatatgctagatttgccgcacccatagct
aaaaaagtgagcgacgagctgagcgtagctggaaaactcactctagagcagttgcaacaa
gcagcgcaacaaggttttaagtcggtgttgaatttacgctctcctgatgaaccaggtttc
ctcagcgacgaacaacagcaagcacaagcagcaggattagattacgctaacattccccta
caatcttcagaaccggatctaatatcaacaaaagaagcaattcgagccactgaaaattta
ccaaagccaattttaatccactgcgctgctggggcaagggcaggtggaatcgctttaatt
gccactgcgattcaacaaggcttaacttacgagcaaattcaggaaaaagctcaacaagtc
gatctcgatttaaatcaaccccacttgcagcaatttctgctggaaaactacactgccaag
caggaaacagaaagttag

DBGET integrated database retrieval system