KEGG   Chroococcidiopsis thermalis: Chro_1139Help
Entry
Chro_1139         CDS       T02360                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cthe00001]
   00620 Pyruvate metabolism
    Chro_1139
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Chro_1139
   00680 Methane metabolism
    Chro_1139
Enzymes [BR:cthe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Chro_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1268551..1271700)
Genome map
AA seq 1049 aa AA seqDB search
MTSLLHSHDEALTISTSPFDLFLRQRLQTVEELWESVLKQECGQELVNLLAQLRDLCSSE
GQAIDEQIAEVVQLISQLELNEAIRAARAFALYFQLINIVEQHYEQRQQLSISRALHQKA
AKQLHQTPQPTSTINGHQTADVNRDPGVELLEKNWHATQQQQKQGTFHTLFPHLRQMNVP
PQHIQRLIDQLDVRLVFTAHPTEIVRSTIRDKQRRLAKLLQQLDRIEESTGSIEGANPWE
AEALREQLTEEIRLWWRTDELHQFKPAVLDEVEYALHYFKEVLFEQIPLLNHRFKHALAS
AFPRLRPPSNNFCKFGSWVGSDRDGNPSVTPQVTWQTACYQRQLVLEKYIHSVKRLTNLL
SISLHWSDVLPDLLESLEQDRLQMNEVYEALALRYRQEPYRLKLAYILKRLENTFERNAR
LYNKNLRKQEIQEENVTTAVYKSGLDFLAELRLIQRNLSETGLNCRELDSLICQVEIYDF
NLAHLDIRQESSRHAHAFNEVLEYLQILPQSYNELSEAERVKWLSEELQTRRPLIPAELP
FSEKTNEAIETLRVVRLLQQEFGVQVCQSYIISMSRDLSDLLEVLLLAKEAGLYDPATGI
GTIQVVPLFETVEDLQRAPSIMQQLFDLTFYRALLAGGYEAIKRESGVGSRESVGQGDKE
TRRQGNNSSHQPLATSHSPLTAHLQEVMLGYSDSNKDSGFLSSNWEIHKAQKALQQVAEQ
HGVDLRIFHGRGGSVGRGGGPAYEAILAQPGHSINGRIKITEQGEVLASKYSLPELALYN
LETISTAVIQASLLRTGFDNIQPWNEILEELAARSRQHYRALIYEQPDFIDFFHQVTPID
EISQLQISSRPARRQGGKKDLSGLRAIPWVFSWTQSRFLLPAWYGVGAALQEFLNEEPEQ
HLKLLRYFYMKWPFFKMAISKVEMTLAKVDMQIAHHYVKELSKPQDLERFERLFEQILQE
FHLTTDLVLSITGHKRLLDGDPVLQQSVQLRSATIVPLGFLQVSLLKRLRQYSNPSTTGI
IDSRHSKGELLRGALLTINGIAAGMRNTG
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgctcctccactcccatgatgaagctttgactatcagcacctctccctttgat
ttgtttttgaggcaacgcctgcaaacagtagaggagttgtgggagtctgttctgaaacaa
gaatgcggtcaagaattagtaaatctcttggcgcaattacgcgatttatgctcgtcagaa
ggacaagcgatcgacgagcaaatagcggaagtcgtacaattaatctctcagttagagttg
aacgaagcaattcgcgctgcgcgtgcctttgcactctatttccagttgattaacattgtc
gagcagcactacgagcaacgccaacaactgagtatcagtcgcgctttgcatcaaaaagca
gctaagcagctacatcaaacgccacaacccacctctacaattaacggacatcaaacagca
gatgtaaatcgagatcctggcgtagagctgttagaaaaaaactggcacgctacccagcag
cagcaaaaacaagggactttccacaccttgtttccccatctacggcagatgaacgtaccg
ccgcaacacattcaacggttgatcgaccaattagatgtcagattagtctttacggcgcac
cccactgagatcgtgcgctctacaattcgggacaagcaaagacgcttagccaagctactg
caacagctcgatcggattgaggaaagtacgggcagtattgaaggtgctaatccttgggaa
gcagaagccctgcgggaacagctcacagaagaaattcgcctctggtggcgcactgacgag
ttacaccaatttaagccagcagtgttagatgaggtagagtacgccctgcactacttcaaa
gaagttctgttcgagcaaattcccttgctgaatcacagatttaaacacgctctggcatct
gcctttccccgcttgcgtccgcctagtaataacttttgtaaatttggttcctgggtagga
tcggatcgggatggcaacccctcagtgacaccccaagttacgtggcaaacggcttgctat
caacgccagttggtgttggaaaaatacattcattcagtcaagcgactgacaaatttattg
agcatatcgctgcactggagcgatgtcctgccagatttattagaatctctggagcaggat
cggttgcagatgaacgaagtgtatgaagcacttgccctgcggtatcgtcaagaaccctat
cggctcaagcttgcctacattttgaagcgactagaaaatacattcgagcgtaacgcgcgc
ctgtacaacaagaatctgcgcaagcaagaaattcaagaagagaacgtcaccacggcagtc
tataaatctgggcttgactttctcgcggaattacgactaattcaacgcaacttgtcagaa
acaggcttaaactgccgagaacttgatagcctgatttgtcaagtagaaatttatgacttt
aacctagctcacctcgatattcgccaagaatcttctcgccacgcccatgctttcaatgaa
gtgttggaatatctacaaattctgcctcagtcatataacgaattgtcagaagcagaaaga
gtcaagtggttgtcggaagaattgcagactcgtcgtccgttgattcccgccgaactacct
tttagtgaaaaaaccaacgaagcgatcgaaactttgcgcgtcgtgcgtttgttacagcaa
gagtttggcgtgcaggtttgccagagttacattatcagcatgagccgcgatctgagcgat
ttgctagaggtgctgttactagctaaagaagctggactctacgatccagcaacaggaatc
gggacgatccaagtcgtacctctatttgagacggtagaggacttgcaacgcgcccccagc
atcatgcaacagctattcgatctgacgttttatcgcgctttgttggcgggagggtatgaa
gcgataaaacgggagtcgggagtcgggagtcgggagtcggtgggacaaggggacaaggag
acaagaagacaaggaaacaattctagtcaccagccactagccactagccactctccactt
actgctcacttacaagaggtgatgttgggttactcagatagcaacaaggattctgggttt
ctcagcagcaattgggaaattcacaaagcgcaaaaagcactccaacaagttgccgaacag
catggagtcgatttgagaatttttcacggacgcggcggctcggtaggacgtggtggtggt
cctgcatacgaggcaattttggctcaacccggacatagtattaatggcagaattaaaatt
accgaacaaggtgaagttttagcttctaaatactcgctgccagagttggcgctttacaat
ttggaaacaatttcgactgccgtgattcaggctagcttgttacgcacgggctttgataat
attcaaccatggaatgaaatattagaagagttagcagcgcgatcgcggcaacattatcgc
gccctgatctacgagcaaccagatttcattgactttttccaccaagtgactccgattgac
gagatcagccaactccaaatcagctctcgccccgcacgacgacaaggtggaaaaaaagat
ttaagtggtttgcgggcaattccttgggtgtttagttggacgcaaagccgttttctccta
cctgcttggtatggtgtcggcgcagctttgcaggaatttttaaacgaggaaccagagcaa
cacctcaaattgttacgttatttctacatgaagtggcccttcttcaaaatggcaatttct
aaagtagagatgacgctggcaaaagtagacatgcaaatcgctcatcactacgtcaaggag
ttatcgaaaccccaagacttagaacgatttgagcggttattcgagcaaattttgcaagag
tttcacctcacaactgacttagtactgagtattacaggtcataaacgcctgctcgacggc
gatccagttttacagcagtccgtgcagttgcggagtgcgacgattgtaccgttaggattt
ttgcaggtttcattgctgaagcgactgcggcaatacagcaacccgagtacgacaggcatc
atcgattctcgccatagcaaaggtgaattgttgcgcggtgcattgttaactatcaatgga
atcgcggctgggatgaggaatactggttga

DBGET integrated database retrieval system