KEGG   Chroococcidiopsis thermalis: Chro_2259Help
Entry
Chro_2259         CDS       T02360                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Chro_2259
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Chro_2259
Enzymes [BR:cthe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Chro_2259
Peptidoglycan biosynthesis and degradation proteins [BR:cthe01011]
 Precursor biosynthesis
  Racemase
   Chro_2259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2528928..2530133
Genome map
AA seq 401 aa AA seqDB search
MLSQEQSEKTVFSNDVVGGLRQRAWVEINLGALAHNVRQLKGLLAAKTALMAVVKADAYG
HGAVTVARTALSAGANWLGVATIPEGIELRQAGIDAPILILGATHTPEQLKAIAHWQLQP
TLCDPKQALVFSETLAATTGGNLPVHVKLDTGMSRLGPLWEQATEFVQLVHSLPHLQIAS
IYSHLATAENPDRRIMQQQQQRFETAIAQVQAASMSLPLLHLANSAATLTSPDLHYDLVR
VGLAMYGLYPAAHLSSSVQLKPVLQVKARITQVKTIPPNTGVSYGHHFVSDRELRLAVVG
IGYADGVPRNLSNRMEALICGRRIPQIGAITMDQLMLDVTAIPDVAVGEVVTLLGQEGKE
QITADDWAAVLKTISWEILCGFKHRLPRVAVNREQGAGSRE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtcaggagcagagtgagaagacggtttttagtaatgatgtcgtgggtggattg
cgtcaaagagcctgggtggaaatcaatttaggtgctttagcccataacgtgcggcaactc
aagggcttgctagcggctaaaacagcgttaatggcagttgtgaaggcagatgcttacggt
catggagcggtgacggtggcacgtacagctttaagtgctggagcaaattggttgggtgtg
gcaaccataccggaaggaattgaactgcgccaagcaggaattgacgcgccgattttgatt
ttaggtgcaacgcatacgccggaacaactaaaggcgatcgcccactggcaacttcaaccg
acgctgtgcgaccccaaacaagctttggtcttctctgaaactttggctgcgactacgggt
ggtaatttaccagttcatgtcaaactcgatacgggaatgtctcgccttggacccctgtgg
gaacaagcaacagagttcgtgcagctagtccattctttaccgcatttgcaaatcgctagt
atttattctcacctggcaacggcagaaaacccagaccgcaggataatgcagcaacaacag
cagcgatttgaaacggcgatcgcacaggttcaagcagctagtatgtctcttccattgctg
catttagccaactcagctgctactttgactagccccgatctacattacgatttggtacgt
gtggggttagcaatgtatggactctacccagcagctcatctcagcagttctgtccagttg
aaacccgtactgcaagtcaaagcgcgaattacgcaggtaaaaacaatcccccccaataca
ggcgtgagctacggacatcattttgtcagcgatcgcgaactccgcttggctgtggtggga
attggttatgctgatggcgtaccgcgcaatctctctaaccgcatggaggctctgatttgc
ggtcggcgcatcccccaaattggtgctattactatggatcagttaatgctagatgtgacg
gcaattccagatgtagcagttggagaagttgtcactctcctcggacaagaaggtaaagaa
caaattactgctgatgattgggcagcagtcttaaaaacaatttcttgggaaatcctctgc
ggctttaagcaccgtctgcctcgggttgctgtgaatagggagcagggagcagggagcagg
gagtag

DBGET integrated database retrieval system