KEGG   Cupriavidus taiwanensis: RALTA_B0932Help
Entry
RALTA_B0932       CDS       T00702                                 

Gene name
sodC
Definition
(GenBank) SUPEROXIDE DISMUTASE CU-ZN PRECURSOR PROTEIN
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cti  Cupriavidus taiwanensis
Brite
Enzymes [BR:cti01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RALTA_B0932 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5
Motif
Other DBs
NCBI-ProteinID: CAQ71545
UniProt: B3R9H0
LinkDB All DBs
Position
2:complement(1000627..1001133)
Genome map
AA seq 168 aa AA seqDB search
MTSSSAAQPSATGASGATSGARASATLQPKSGSNTAGTVTFQQQPGGVMMTAAITGLPPN
SVHGFHVHEKGDCSAPDAMSAGGHFNPGGKPHGQMTMPDHHAGDMNNVTADANGNVRVSM
LLPSLSVGTGANSVIGRAVVVHKDPDDYKTQPTGNAGGRIACGVVAAS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgtcgtccgcggcccagccctccgccaccggcgccagcggtgccaccagcggt
gcccgggcctcggccacactgcagcccaagagcggctccaacaccgcgggcaccgtcacc
ttccagcagcagcccggcggcgtgatgatgaccgccgcgattaccgggctgccgcccaat
tcggtccatggcttccacgtccacgagaagggcgactgttccgcgcctgacgccatgagc
gcgggcggacatttcaatccgggcggcaagccgcacgggcagatgaccatgccggaccac
catgccggcgacatgaacaacgtcaccgccgatgccaatggcaacgtgcgcgtcagcatg
ctgctgccgtcgctgtcggtgggcaccggcgccaacagcgtgatcggccgcgcggtggtc
gtgcacaaggatccggacgactacaagacgcagcccaccggcaatgccggcggccgcatt
gcctgcggcgtggtggcggcgtcctga

DBGET integrated database retrieval system