KEGG   Cupriavidus taiwanensis: RALTA_B1365Help
Entry
RALTA_B1365       CDS       T00702                                 

Gene name
TreS
Definition
(GenBank) Trehalose synthase, Maltose alpha-D-glucosyltransferase; Alpha amylase, catalytic subdomain
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cti  Cupriavidus taiwanensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RALTA_B1365 (TreS)
Enzymes [BR:cti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RALTA_B1365 (TreS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RALTA_B1365 (TreS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1458814..1462179
Genome map
AA seq 1121 aa AA seqDB search
METRMKRLTETASAALLNADPLWYKDAVIYQLHIKSFFDANGDGVGDFAGLLGKLDYLVN
LGVDTVWLLPFYPSPRRDDGYDIADYRNVHPDYGTLADARRFIAAAHARGLRVVTELVIN
HTSDQHPWFQRARKAKPGSAARRYYVWSDHDQAYAGTRIIFCDTEKSNWSWDPVAGAYFW
HRFYSHQPDLNFDNPQVLNEVLSVMRFWLDMGVDGLRLDAVPYLVEREGTSNENLPETHA
VIRAIRSHLDQHFPGRMLLAEANMWPEDAQQYFGLTGPDPEGDECHMAFHFPLMPRMYMA
IAREDRFPITDIMRQTPEVPPNCQWAIFLRNHDELTLEMVTSSERDYLWEVYATDRRARI
NLGIRRRLAPLMERDRRRIELMNSLLFSMPGTPVIYYGDEIGMGDNIHLGDRDGVRTPMQ
WSPDRNGGFSHADPERLVLPPLQGPLYGYEAVNVEAQARDPHSLLNWMRRMLALRRKHRA
FGRGTLRFLFPGNRKILAYLREFEGEHILCVANLSRAPQAVELDLSAFNGRVPVEMMGAT
PFPAIGTLTYLLTLPPYGFYWFVLSDEAQPPSWHVEAPEQMPDQITLVMQNTGRPELTEA
SRRLMANEVLPHYIGRRRWFGAKHERIERVALAYLLPFTRGGGGEDIYLGEVEVALPGRT
ERYQLPVGILWDRESADGVSQLAHGLSMARVRQGSRVGLATDGFVVEPFAREVVRALRND
VKLHAGHDVIHFRAEPGLAALELERDPIEYMSAEQSNSSLSYNNSAVLKLVRRLSGGIHP
EAEMTRYLTAQGYAHAAALLGEVVRTGPDGVPHTMMLLQGYILNQGNGWDWTLDYLGRAI
DDALPSQESEDEFAEAMNGYAALAGTLGRRLAELHAVLARPTDDDAFAPLPATGDDARAW
AGQAMEALQRALNRLQQRPVAEPASPAFEADVQALMAARDTLPGLVEKLATAAPGSLQTR
IHGDFHLGQVLIAQNDTYLVDFEGEPGLPLDWRRRKTSPLRDVAGLLRSLDYAAATVGTD
RSERTHSELPPQLAERRAVLLERFRTTANEAFLNCYRQHMEAAPVPWVAPDQLQPLLDLF
LLERAAYEVEYEAANRVAWIDLPASGLARLLRKLAPPGGQP
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
gtggagacacggatgaaacgccttaccgaaaccgccagcgccgccctgctcaacgccgac
ccgctctggtacaaggacgcggtgatctaccagctgcacatcaagtccttcttcgacgcc
aatggcgacggcgtgggcgacttcgccggcctgctcggcaagctggattatctggtcaac
ctgggcgtcgacacggtatggctgctgccgttctatccgtcgccgcgccgcgacgacggc
tatgacatcgccgactaccgcaacgtccacccagactacggcacgctcgcggatgcgcgg
cgctttatcgccgcggcgcacgcgcgcggcctgcgcgtggtcaccgaactggtgatcaac
catacctcggaccagcatccgtggttccagcgcgcgcgcaaggccaagcccggctcggcg
gcgcgccgctattacgtgtggtcggaccatgatcaggcctatgccggcacgcgcatcatc
ttctgcgataccgaaaagtccaactggagctgggatccggtggcgggcgcgtatttctgg
caccgcttttactcgcaccagcccgacctgaacttcgacaacccgcaggtgctcaacgaa
gtgctgtcggtgatgcgcttctggctcgacatgggcgtcgatggcctgcgcctggacgcg
gtgccctacctggtcgagcgcgaaggcaccagcaacgaaaacctgcccgagacccatgcc
gtcatccgcgccatccgttcccacctggaccagcatttccccgggcgcatgctgctggcc
gaggccaatatgtggccggaggatgcgcagcagtacttcggcctgaccgggcccgacccg
gagggcgacgaatgccacatggcgttccacttcccgctgatgccgcgcatgtacatggcg
atcgcgcgcgaagaccgctttccgatcaccgacatcatgcgccagacgccggaggtgccg
cccaactgccagtgggcaatcttcctgcgcaaccatgacgagctgacgctggagatggtg
accagcagcgagcgcgactacctgtgggaggtctacgccaccgaccggcgcgcgcgcatc
aacctgggcatccgccgtcggctggcgccgctgatggagcgcgaccgccgccgcatcgag
ctgatgaacagcctgctgttctcgatgccgggcacgccggtgatttactacggcgacgag
atcggcatgggcgacaacatccacctgggcgaccgcgacggcgtgcgcacgccgatgcag
tggtcgccggaccgcaacggcggcttctcgcatgccgacccggagcgcctggtgctgccg
ccgctgcaaggcccgctgtatggctacgaggcggtcaatgtcgaggcccaggcgcgcgat
ccgcattcgctgctgaactggatgcggcgcatgctggcgctgcgccgcaagcaccgcgcc
ttcggccgcggcacgctgcgcttcctgtttcccggcaaccgcaagatcctggcttacctg
cgcgagttcgagggcgagcacatcctgtgcgtggccaacctgtcgcgcgccccgcaggcg
gtagagctggacctgtccgcgttcaacgggcgcgtccccgtcgagatgatgggcgcgacg
ccattcccggccatcggcacgctgacctacctgctgacgctgccgccctatggcttctac
tggttcgtgctgagcgacgaggcgcaaccgccatcgtggcacgtggaggcgccggaacaa
atgccagaccagatcacccttgtgatgcagaacaccggccggcccgagctgaccgaggcc
tcgcgccggctgatggccaacgaagtgctgccgcactacatcggccggcgccgctggttc
ggcgccaagcacgaacgcatcgagcgcgtcgcgctggcctacctgctgccgttcacacgc
ggcggtggcggcgaggacatctacctgggcgaggtggaagtagcgctgcccgggcgcacc
gagcgctaccagttgccggtgggcatcctgtgggaccgcgaaagcgccgacggggtctcg
cagctggcgcatggcctgtcgatggcgcgcgtgcgccagggcagccgcgtcgggctggcc
accgacggcttcgtggtcgaaccgtttgcgcgggaggtggtgcgcgccttgcgcaacgac
gtgaagctgcatgccgggcacgacgtcatccacttccgcgccgagccagggctggccgcg
ctggaactggagcgcgacccgatcgagtacatgtccgccgagcagtccaacagctcgctg
tcgtacaacaattccgccgtgctcaagctggtgcgccggctctcgggcggcattcacccc
gaggccgagatgacgcgctacctgaccgcgcagggctatgcgcacgccgcggcactgctg
ggcgaggtggtgcgcaccgggcccgacggcgtgccgcataccatgatgctgctgcagggc
tatatcctgaaccagggcaacggctgggactggacgctcgattacctgggccgcgccatc
gacgacgcgctgccgtcgcaggagagcgaagacgagttcgccgaggccatgaacggctac
gccgcgctggccggcacactggggcgccggctggccgaactgcatgcggtgctggcgcgc
cccaccgacgatgacgccttcgcgcccctgcccgccaccggtgacgacgcgcgcgcctgg
gccgggcaggcgatggaggcactgcagcgcgccctgaaccggctgcagcaacggcccgtg
gccgagccggcaagccccgccttcgaggccgatgtgcaagccctgatggccgcgcgcgat
acgctgcccggactggtcgagaagctcgccacagcggcgccgggcagcctgcagacccgc
atccacggcgacttccacctcggacaggtgctgatcgcgcagaacgacacctacctggtc
gacttcgaaggcgagcctggcctgccgctggactggcgccggcgcaagacctcgccgctg
cgcgacgtggccgggctgctgcgctcgctcgactatgccgcggccacggtcggcaccgac
cgcagcgaacgcacccacagcgaactgccaccgcagttggcggaacggcgcgcggtgctg
ctggagcgcttccgcaccaccgccaacgaggccttcctgaactgctaccgccagcacatg
gaggcggcccccgtgccatgggtggcgcccgaccagctgcagcccctgctcgatctgttc
ctgctggaacgtgcggcgtatgaagtcgaatacgaagccgccaaccgcgtcgcgtggatc
gacctgcccgccagtgggctggcccgcctgctgcgcaagctggccccgccgggaggacag
ccatga

DBGET integrated database retrieval system