KEGG   Clostridium tyrobutyricum: CTK_C25780Help
Entry
CTK_C25780        CDS       T04331                                 

Gene name
sod
Definition
(GenBank) superoxide dismutase (Fe/Mn family)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ctyk  Clostridium tyrobutyricum
Brite
Enzymes [BR:ctyk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CTK_C25780 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2555505..2556152
Genome map
AA seq 215 aa AA seqDB search
MYNLKPETFDFRSVKGISQRQLDEHYKLYKGYVDNLNKIWNTPYIPNNFSDSNPTYSKMR
SLKLGETYSLDGVKLHELYFQNMTGGSKNPYGPVLNAIMDQFSSYDNFISYFTNVGLSMR
GWAVLTIDSIDNKFHIIGSDLHDKGAIWLSYPILILDVYEHAYFMDFGTDRKKYISEFIK
NINWNVLNSRFQKYIYLMQSKNARQYGQYPFRFFY
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtataatttaaaacctgaaacttttgattttagatccgtaaaaggtatttcccaaaga
caacttgatgaacattataaattatataaaggatatgtagacaatctaaataaaatctgg
aatacgccgtatattcccaataattttagtgacagcaatccaacttattcaaaaatgcga
agcttgaaacttggagaaacctattcgctggatggtgtaaaactccacgagctctacttt
caaaatatgacaggtggcagtaaaaatccttatggacctgtgcttaatgctataatggat
caattttcatcttatgataattttatatcttattttacaaatgtaggattatccatgaga
ggatgggctgttctaactattgattcaattgacaacaaattccacataataggaagtgac
ctacatgataaaggggcgatttggctttcatatccaatattaatacttgatgtatacgaa
catgcctattttatggatttcggaacagataggaaaaaatatatttctgaatttataaaa
aacataaactggaatgtgttgaattcaagatttcaaaaatatatttatttaatgcagtct
aaaaatgctagacaatatggtcaatatccctttagattcttctactaa

DBGET integrated database retrieval system