KEGG   Curtobacterium sp. BH-2-1-1: BJK06_16365Help
Entry
BJK06_16365       CDS       T04562                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cub  Curtobacterium sp. BH-2-1-1
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cub00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BJK06_16365
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJK06_16365
  Energy metabolism
   00680 Methane metabolism
    BJK06_16365
Enzymes [BR:cub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BJK06_16365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3450129..3452783
Genome map
AA seq 884 aa AA seqDB search
MTIDGQTRHGRARDDVSGAVDSDLRSDVRYLGKLLGRVLRETGGEDLLHDVESLRAAVID
AYEGGEAEGAARAEAIVADLSAERAEAVAQAFTTYFHLTNLAEEHHRVRVLRHRGDDGGL
AGDSFPATYASLVEQVGDEAAAARLRELRFHPVLTAHPTEARRRAVTTAVRRITDLIDER
DRTTNATALAENERRLLEEITTLLRTSPLRTTRPTPLDEVRTAMSVFDQTLFEIVPQVYR
LLDDRLLGDDAGRVPVTAPAFVRFGTWIGGDRDGNPHVTAVVTRQAAEIAAEHILLGLSR
AATRIGSTLTLDASETPADAGLTALVAAQESLDPGIAERIGVRAPNETHRRALLFVAARI
DATRRGEAELAYPGPDALLADLRTIQTSLVAAGATRPANGELQNLVWQVETFGFHLAELE
VRQHSQVHRNALAEIRAGGELSETTEEVLAVFRTIAALQARYGVRAASRYIVSFTQSAAD
LANVHELAVAALGSPEAAPVLDVIPLFETFADLHASVDILDEAVRTEPFQRRLAATGRRL
EVMLGYSDSSKDVGPVSANLALYDAQARIADWAKHNDVELTLFHGRGGSLGRGGGPANEA
VLAQPRGSIDGRLKLTEQGEVIFAQYGDKDIAARHLEQMASATLFASSPSNEDRTAVAAM
RFADLAQQLDDVSREAFYGLVKADGFAPWFARVTPMEEIGLLPLGSRPARRGLSVESLED
LRAIPWVFSWTQARINLAGWYGLGSALEAVGDVELLRTAYAEWPLFGAMIKNVEMSLAKT
DEHIARRYLELADRDDLAAKVLDEMLRTREWVLRVSGGSDVLEDRPVLARAVRLRSPYVD
ALSHLQLRALRAIRTSGSTDPTDGDHRLLLLTVNGIAAGLQNTG
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgacggtcagacgcgccacggacgcgcgcgggacgacgtcagtggcgcggtc
gacagcgacctgcgctccgacgtgcggtacctcggcaagctgctcggacgcgtcctgcgg
gagaccggcggcgaggacctcctgcacgacgttgagagcctccgcgccgcggtcatcgac
gcgtacgagggcggcgaggccgagggcgccgcgcgtgccgaggccatcgtcgcggacctg
tccgccgagcgggccgaggccgtggcccaggcgttcaccacgtacttccacctcacgaac
ctcgccgaggagcaccaccgcgtccgcgtgctccggcaccgcggcgacgacggcggactc
gcgggggactccttcccggcgacgtacgcctcgctcgtcgagcaggtcggtgacgaggcc
gctgcggcccggctgcgcgaactccggttccacccggtcctcacggcgcacccgaccgag
gcccgccgacgcgcggtgaccacggccgtgcggcgcatcaccgacctcatcgacgagcgc
gaccggacgacgaacgccacggccctcgccgagaacgagcgccggctgctcgaggagatc
acgaccctcctgcgcacctcgccgctccgcacgacccgcccgaccccgctcgacgaggtc
cgtacggcgatgagcgtgttcgaccagacgctgttcgagatcgtcccgcaggtctaccgc
ctgctcgacgaccggctgctcggtgacgacgccggccgcgtgccggtcaccgcaccggcc
ttcgtgcgcttcggtacctggatcggcggcgaccgcgacggcaacccgcacgtcaccgcg
gttgtcacccgccaggcggcggagatcgcggccgagcacatcctgctcgggctctcccgt
gccgccacccgcatcggcagcaccctgaccctcgacgcgagcgagaccccggcggacgcc
ggtctcaccgcgctcgtcgccgcgcaggagtccctcgaccccgggatcgccgagcgcatc
ggggtccgtgcgccgaacgagacgcaccgtcgggcgctgctgttcgtcgccgcccgcatc
gacgccacgcgccggggcgaggccgagctcgcctaccccgggccggacgcgctcctggcc
gacctccgcaccatccagacctcgctcgtcgcggccggggccacccgtcccgcgaacggc
gagctgcagaacctcgtctggcaggtcgagaccttcgggttccacctcgccgagctcgag
gtccggcagcactcgcaggtgcaccggaacgccctcgcagagatccgcgccggtggggag
ctgagcgagaccacggaagaggtcctcgccgtgttccgcacgatcgccgcgctgcaggcc
cgctacggcgtccgcgccgccagccgctacatcgtgtcgttcacgcagtcggcagccgac
cttgcgaacgtccacgagctcgcggtcgccgcactcgggtcgcccgaggccgccccggtg
ctcgacgtcatcccgctgttcgagaccttcgcggacctgcacgccagtgtcgacatcctc
gacgaggccgtccgcaccgagccgttccagcgtcgcctcgcagcgaccggtcgccgcctc
gaggtcatgctcggctactccgactcctccaaggacgtcggtccggtgtcggcgaacctc
gcgctctacgacgcacaggcccggatcgccgactgggcgaagcacaacgacgtcgagctc
acgctgttccacggccgcggcggctcgctcggccgcggtggtggcccggcgaacgaggcc
gtcctggcgcagccccgcggttccatcgacggacgcctcaagctcaccgagcagggcgag
gtcatcttcgcccagtacggcgacaaggacatcgccgcgcggcacctcgagcagatggcc
tcggcaacgctgttcgcgtcctcgccgtcgaacgaggaccgcacggccgtcgccgccatg
cgcttcgccgacctcgcgcagcagctcgacgacgtctcgcgcgaggcgttctacggcctc
gtgaaggcggacggcttcgcgccgtggttcgcgcgcgtgaccccgatggaggagatcggt
ctgctcccgctcggctcccgtccggcccgccgcggtctgagcgtcgagtcgctcgaggac
ctccgggcgatcccgtgggtgttctcgtggacgcaggcgcgcatcaacctcgccgggtgg
tacggcctcggttccgcgctcgaggccgtcggcgacgtggagctcctccgcaccgcgtac
gccgagtggcccctcttcggcgcgatgatcaagaacgtcgagatgtcgctcgcgaagacc
gacgagcacatcgcccgccggtacctcgagctcgcggaccgcgacgacctcgccgcgaag
gtcctcgacgagatgctccgcacgcgcgagtgggtgctgcgcgtctcgggcgggagcgac
gtcctcgaggaccgtcccgtcctcgcacgcgccgtccggctccgcagcccgtacgtcgac
gcgctctcgcacctgcagctccgggcgctccgcgcgatccgcacctcgggcagcacggac
ccgacggacggtgaccaccggctgctcctcctcaccgtgaacggcatcgcggccggcctg
cagaacacgggctga

DBGET integrated database retrieval system