KEGG   Corynebacterium ulcerans 809: CULC809_00434Help
Entry
CULC809_00434     CDS       T01880                                 

Gene name
nanH
Definition
(GenBank) sialidase precursor
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CULC809_00434 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CULC809_00434 (nanH)
Enzymes [BR:cuc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CULC809_00434 (nanH)
Bacterial toxins [BR:cuc02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CULC809_00434 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
475179..477320
Genome map
AA seq 713 aa AA seqDB search
MCWLSHFCVFHPSQGRKFPMTDSRRRGTRKALITLTAALALTAQGLAVPTVFAEEALSPA
TAPLDNNGLFDAAPPAPVARGAAGEKGLREPVEQPFFSEKIIRDVDAADRRCFRIPAIAT
AVDGSLLVAFDNRYSNGNKTWCRDAPFENRQINSPEKQTDIEVMRSGDNGESFGVETPIA
RGTEDSRSISYTDPSFVVDQVSGKIFAVFVRAMDYRFFDATAGVNRGSAEDPIQKRSVQD
TVMVESNDNGRSWGNMKLLSELTETIEVRHKPGQKIAGRGRFATSGNGIQLKYGDNAGRL
LFPMSVHYSPNGAGAVANVALYSDDHGVTWNVGKGVGGEGEMNGDENKLVELSDGRIMMN
SKSMGSNPSNPKGAERWRSYSEDQGETWSKPEQVIVAPPQYPAQRNTGINVSLIRAYPSA
PKDSAAAKVLLYSAPIDTRIKGDYGQDGRSNGWVMASCDDGQTWKYGKQVESGRFQYSVM
TPMADGNIGMAYESGDDKKGMTLKFAKFNMAWLGADCLSNKALGITDLPDPALAKAIEDA
KAATAKAEEATANVVRLTKELEDLEIDREELLEALDKAKAAAQKAITAAEEANAKVKAAE
EATAKAEESAAKAEDEAKALAEQLAKVEEELAKSQDQAKVLAEAKEAAEIAQKAAEEALR
LEKEKNKTDKDTDNTENKGFWQGLLQVLPGLAPIFSFLASLWDGIQKLFGAKA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtgttggctgtctcatttttgtgtgtttcatccatctcaaggaaggaagtttccaatg
acggattcacgccgccgtggaactcgcaaagcgctgataactctcacagcagcgcttgct
ctcactgctcaaggccttgcggtccctacagtttttgccgaagaagccctcagccctgca
actgctcccctcgataacaatgggcttttcgacgccgctccgcccgcccctgtagcgcgt
ggcgctgcaggggaaaaaggcctccgtgaacctgtggaacagcctttctttagcgaaaaa
atcatccgagatgttgatgctgccgataggcgttgcttccgtattccagctattgctaca
gctgtagatggttcgcttcttgttgcttttgacaatcgctatagcaatggaaataaaacg
tggtgtagggatgcaccatttgaaaacagacagatcaacagcccggagaaacaaacagac
attgaggtaatgcgctcgggcgataatggtgaaagctttggggtggaaacccctattgct
aggggtacggaggatagccgtagtatttcttatactgatccttcatttgtagttgatcag
gttagcggaaaaatttttgcagtctttgtgcgtgcgatggattaccgtttcttcgatgca
accgcaggtgtaaataggggttctgctgaggacccgatacaaaaaagatcggttcaagac
acggtcatggttgagtcgaatgacaacggtcgttcctggggaaatatgaaacttctcagc
gagctaacggaaacgattgaggttcggcataaaccggggcagaagattgcgggacgcgga
aggtttgcaacttctggtaatgggatccaattaaaatatggggataacgcgggccgatta
cttttcccgatgtcggtgcactacagcccaaatggcgctggagctgttgcgaatgtagcg
ctttattctgatgatcacggagtgacgtggaacgttggaaaaggtgtcgggggagaaggc
gagatgaatggagacgaaaataaactagtagagctctccgatggccggattatgatgaat
tcgaagagtatgggaagtaatccgagtaatcctaaaggtgcagagcgttggagatcttat
tcagaagatcaaggggaaacttggagtaaacctgaacaggtgattgttgcgccaccgcag
tatccggcgcaaagaaacaccggtattaatgtctctttaattcgagcgtacccatctgct
cctaaagatagtgctgcagcaaaggtcttgttgtactctgctccgattgatactcgtatt
aaaggggactatgggcaagacggacgtagtaatggctgggtcatggcttcctgtgatgat
ggacagacatggaaatatggcaagcaagttgagtctggccgtttccaatattcggtcatg
actcccatggctgatggcaatatcggtatggcttatgagtctggtgacgataagaaaggt
atgaccctcaagttcgccaagttcaacatggcgtggctgggcgctgattgcttgagtaat
aaggccctgggtatcactgatctgccggatcctgctttggccaaggccattgaagacgcg
aaagctgcgacggctaaggctgaggaggctacggcgaacgtcgtaaggctaacaaaggag
ctagaggatcttgagatcgatagggaagaactgctagaagctctggacaaggctaaggcg
gcagcgcagaaagccattactgctgcggaagaggctaatgccaaggttaaggccgctgag
gaggctacggcgaaagccgaagaatccgctgcaaaggcagaggatgaggctaaggccctt
gcagagcaattggccaaggttgaggaggaattagcaaaatcccaagatcaggcaaaggtt
ctcgctgaggctaaagaggctgccgagattgctcaaaaagcagcagaagaggcgcttagg
ttggagaaagagaagaacaaaacagataaagacacagataacaccgaaaataaaggtttt
tggcaaggtcttttgcaagtcttgccaggacttgcgcccattttcagtttcttagcatcg
ctatgggatgggatacagaaattatttggggctaaagcctaa

DBGET integrated database retrieval system