KEGG   Corynebacterium ulcerans 210931: Cul210931_0440Help
Entry
Cul210931_0440    CDS       T03414                                 

Gene name
nanH
Definition
(GenBank) Sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cuq  Corynebacterium ulcerans 210931
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cuq00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cul210931_0440 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cul210931_0440 (nanH)
Enzymes [BR:cuq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Cul210931_0440 (nanH)
Bacterial toxins [BR:cuq02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Cul210931_0440 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
463361..465502
Genome map
AA seq 713 aa AA seqDB search
MCWLSHFCVFHPSQGRKFPMTDSRRRGTRKALITLTAALALTAQGLAVPTVFAEEALSPA
TAPLDNNGLFDAAPPAPVARGAAGEKGLREPVEQPFFSEKTIRDVDAADRRCFRIPAIAT
AVDGSLLVAFDNRYSNGNKTWCRDAPFENRQINSPEKQTDIEVMRSGDNGESFGVETPIA
RGTEDSRSISYTDPSFVVDQVSGKIFAVFVRAMDYRFFDATAGVNRGSAEDPIQKRSVQD
TVMVESNDNGRSWGNMKLLSELTETIEVRHKPGQKIAGRGRFATSGNGIQLKYGDNAGRL
LFPMSVHYSPNGAGAVANVALYSDDHGVTWNVGKGVGGEGEMNGDENKLVELSDGRIMMN
SKSMGSNPSNPKGAERWRSYSEDQGETWSKPEQVIVAPPQYPAQRNTGINVSLIRAYPSA
PKDSAAAKVLLYSAPIDTRIKGDYGQDGRSNGWVMASCDDGQTWKYGKQVESGRFQYSVM
TPMADGNIGMAYESGDDKRGMTLKFAKFNMAWLGADCLSNKALGITDLPDPALAKAIEEA
KAATAKAEEATANVVRLTKELEDLEIDREELLEALDKAKAAAQKAITAAEEANAKVKAAE
EATAKAEESAAKAEDEAKALAEQLAKVEEELAKSQDQAKVLAEAKEAAEIAQKAAEEALR
LEKEKNKTGKDTDNTENKGFWQGLLQVLPGLAPIFSFLASLWDGIQKLFGVKA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtgttggctgtctcatttttgtgtgtttcatccatctcaaggaaggaagtttccaatg
acggattcacgccgccgtggaactcgcaaagcgctgataactctcacagcagcgcttgct
ctcactgctcaaggccttgcggtccctacagtttttgccgaagaagccctcagccctgca
actgctcccctcgataacaatgggcttttcgacgccgctccgcccgcacctgtagcgcgt
ggtgctgcaggggagaagggtctccgtgaacctgtggaacagcctttctttagcgaaaaa
accatccgagatgttgatgctgccgataggcgttgcttccgcattccagctattgctaca
gctgtagatggttcgcttcttgttgcttttgacaatcgctacagcaatggaaataaaacg
tggtgtagggatgcaccatttgaaaacagacagatcaacagcccggagaaacaaacagac
attgaggtaatgcgctcgggcgataatggtgaaagctttggggtggaaacccctattgct
aggggtacggaggatagccgtagtatttcttatactgatccttcatttgtagttgatcag
gttagcggaaaaatttttgcagtctttgtgcgtgcgatggattaccgtttcttcgatgca
accgcaggtgtaaataggggttctgctgaggacccgatacaaaaaagatcggttcaagac
acggtcatggttgagtcgaatgacaacggtcgttcctggggaaatatgaaacttctcagc
gagctaacggaaacgattgaggttcggcataaaccggggcagaagattgcgggacgcgga
aggtttgcaacttctggtaatgggatccaattaaaatatggggataacgcgggccgatta
cttttcccgatgtcggtgcactacagcccaaatggcgctggagctgttgcgaatgtagcg
ctttattctgatgatcacggagtgacgtggaacgttggaaaaggtgtcgggggagaaggc
gagatgaatggagacgaaaataaactagtagagctctccgatggccggattatgatgaat
tcgaagagtatgggaagtaatccgagtaaccctaaaggtgcagagcgttggagatcttat
tcagaagatcaaggggaaacttggagtaaacctgaacaggtgattgttgcgccaccgcag
tatccggcgcaaagaaacaccggtattaatgtctctttaattcgagcgtacccatctgct
cctaaagatagtgctgcagcaaaggtcttgttgtactctgctccgattgatactcgtatt
aaaggggactatgggcaagacggacgtagtaatggctgggtcatggcttcctgtgatgat
ggacagacatggaaatacggtaagcaagttgagtctggccgcttccaatattcggtcatg
actcccatggctgatggcaatatcggtatggcttatgagtctggtgacgataagagaggg
atgaccctcaagttcgccaagttcaacatggcgtggctgggcgctgattgcttgagtaat
aaggccctgggtatcactgatctgccggatcccgctttggccaaggccattgaagaggcg
aaagctgcgacggctaaggctgaggaggctacggcgaacgtcgtaaggctaacaaaggag
ctagaggaccttgagattgatagggaagaactgctagaagctctggacaaggctaaggca
gcggcacagaaagccattactgctgcggaagaggctaatgccaaagttaaggccgctgag
gaggctacggcgaaagccgaagaatccgctgcaaaggcagaggatgaggctaaggccctt
gcagagcaattggccaaggttgaggaggaattagcaaaatcccaagatcaggcaaaggtt
ctcgctgaggctaaagaggctgccgagattgctcaaaaagcggcagaagaggcgcttagg
ttggagaaagagaagaacaaaacaggtaaagacacagataacaccgaaaataaaggtttt
tggcaaggtcttttgcaagtcttgccaggacttgcacccattttcagtttcttagcatcg
ctatgggatgggatacagaaattatttggggttaaagcctaa

DBGET integrated database retrieval system