KEGG   Corynebacterium uterequi: CUTER_01485Help
Entry
CUTER_01485       CDS       T03957                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cut  Corynebacterium uterequi
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cut00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CUTER_01485
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CUTER_01485
Enzymes [BR:cut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CUTER_01485
Bacterial toxins [BR:cut02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CUTER_01485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(303419..308284)
Genome map
AA seq 1621 aa AA seqDB search
MSDVETMKNRLIASLATVTLLAGSGQIVAPALATAQDATGAAEPAPAAAVDAPAGEANPA
AEAPAPAPEPAPEPAPAPTPAPAPAPEPPTPTTEAPAETSTPATTEAPEEPAVTSVPITI
TVAKPKPDGKPFDVGDTIRFHFEVTNSTDTARAFQPESSNLDNFAGCKWESIRPGEKKTC
DFATHTVTAEDAAAGFFTPEITYKMFAETGYKGTTQTLDVTRGEQVKVTKVDAQIIEVTA
EKPKDDEGYKANDEVAITAKVRNLNATDELKLSVDPTSDIKADKDLAPIAAGQEAELKDL
KYTITEEDAETGSATPELVLTTAGGQSLKAKVTIAVTGHFDPAESFTPRNANPTLAPSLT
DLNVIATSDGKNIFRIPALAVASNGDILASYDLRPKNGARQGGDSPNENWIVQRRSTDNG
RTWGPQTVIAKGKMNPGREGFSDPSYVVDHETGTIFNFHVHSFDAGFNYGSPAYHLDESG
RVKEDARSTMNLGVAESKDNGHTWTERDITAEALGDKAKDLVACFATSGAGTQKLNAPHQ
GRLLQQAVCSFKEKGHNYAAVTIYSDDHGKTWHSGNFASTTEGGNWAYDENKIVELSDGR
LMLNSRPSGGTASGHRIVAISDDGGENWKDYRVQKDLLDPQNNAQVMRAFPTARPGTLRS
KVLVFSNTRNSTVGFANRQPGTISLSFDDGATWPVSKQFRAARTGYTTMAIQPDGSIGVL
YEPQTGGKDQIGYQNFTLSWVTDQLESEPGLKSTRGTLIDGAEAKLVLPLRGNDPTLADT
IKVEGLPEGLRFDEKTMTIVGTPKVGNTDRKTYPLTVTFSEGDDGTGIPRAFTGTYQLVL
NPEGATYGAQPAAVQASNLELADHKALLALLQKPEPLTWLFTGDSITHGVVHTNGLKRFT
EYFEDYLHTDPLAGADRRHDVVLNTGVSSANTADQANPPGLRKYAGPWVADRKADVVFIT
FGMNDGRESAVAVDKYRANLQATIDEVRASGAIPVLMTQNFTTDPVKNKRLIEYVKTGRE
LAAENKVMIVDFAGWWEEQSDGALVMPAMMNDQLHPNQQGHLDWAQLILYQLGLLNDGSR
LAQRETASAPSYGGARLALPQDKVDTTTLFGTSGVATPAVAQDLKGKKFDGTATKVESDK
ISAFAGASTANITTRFRTEPGLNTATEHVLINMADKDSKKKLTVGLHNNGIRVGLDQTGS
KYAYFTVPNLKVTDGAFHTVSINFSQADFDLFVDGTKVATKSLNGYRFDPKFFGIDTVSV
GGSLKDLTPTGTKNAPAFVDYVEFFSRELTDQEIAGIRNEAANKSVTPQLRALFHNTTPQ
MWAFLGGGTTRGTMAEMTAKNYVQAIEEVLRWESGNKDPMLRMKFVENAGVDGATAATLV
DRYRSVVAEQKPAVVVIAPDVLAGGALVEKDPAAFKAQIAGLIDEASAAGSQVLLLTPPQ
LSEDAKPYAEALRELATEKNTSLVDAYAWLAEAAEINGAEKVTAEWFDGTGHMRAKGQLA
LAKFIMDTIGLMPENVKASEIWGLNYSGNGQPATGDAPGFATPSAGEQQDDGAEPGTQPD
TPDTPQPGNKPGDQPNDEPGSQPDNDDGATASLSSVASTIGRTVVGWITMIIDAIRGLFG
I
NT seq 4866 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgtcgaaactatgaagaacaggctgatagcgagcctggccaccgtcaccctc
ctagccggatccgggcagatcgttgcccccgccttggccaccgcccaagacgccaccggc
gccgccgagcccgcccccgctgccgccgtcgatgccccagccggcgaggcgaacccagca
gccgaggcaccagcccccgcacccgaacccgcacccgaacccgcgcccgcgcccaccccg
gcgccggctcccgccccggagcccccgactcccaccaccgaggcgccggccgagacctcc
accccggcgaccacggaagcaccggaggagccagccgtcacgtcggtgccgatcaccatc
acggtggcgaagccgaagccggacggcaaacccttcgatgtcggtgacaccatccgcttc
cacttcgaggtcacgaactccaccgataccgcccgtgccttccagcccgagtcgtccaac
ctcgacaacttcgccggctgcaagtgggagtccatccgccccggtgagaagaagacgtgc
gacttcgccacccacaccgtcaccgcggaggacgccgccgccggcttcttcaccccggag
atcacctacaagatgttcgccgagaccggatacaagggcaccacccagacgctggatgtc
acccgcggcgagcaggtgaaggtcacgaaggtcgacgcccagatcatcgaggtcaccgcc
gagaagcccaaggatgacgagggctacaaggccaatgacgaggtggccatcaccgcgaag
gtgcgcaacctcaacgccaccgatgagctcaagctcagcgtggacccgacgtcagacatc
aaggccgataaggacctcgcccccatcgcggccgggcaggaagcggagctgaaggatctg
aagtacacgatcaccgaggaggacgccgagaccggctcggccaccccggagctcgtgctc
accaccgcgggcgggcagagcctcaaggcgaaggtgaccatcgccgtcaccggtcacttc
gaccccgctgaaagcttcaccccgcgcaacgcgaacccgacgctggcgccgtcgctcacc
gacctcaacgtcatcgctacctcggacggcaagaatatcttccgcatccccgccctggcg
gtggcgtcgaatggcgacatcctcgcctcctacgacctccggccgaagaatggcgcccgt
cagggcggtgactcccccaacgagaactggatcgtccagcgccgctccaccgacaatggc
cgcacctgggggccgcagaccgtcatcgccaagggcaagatgaaccctggccgagagggc
ttctccgacccctcctacgtggtcgaccacgaaaccggcaccatcttcaacttccacgtc
cactccttcgacgccgggttcaactacggctcccccgcctaccacctcgacgagtccggc
cgggtgaaggaagacgcccgcagcaccatgaacctgggcgtggccgaatccaaggacaac
ggacacacctggaccgagcgcgacatcaccgccgaggccctcggcgacaaggcgaaggac
ctcgtcgcctgcttcgccacctccggcgccggcacgcagaagctcaacgccccgcaccag
ggccgcctcctgcagcaggccgtgtgctcctttaaggagaaggggcacaactacgcggcc
gtgaccatctactccgatgaccacggcaagacctggcactccggcaacttcgcctccacc
acggagggcgggaactgggcctacgacgaaaacaagatcgtcgagctgtccgacggccgc
ctcatgctcaactcccgcccctccggcggcaccgcctccgggcaccgcatcgtggccatc
tccgacgacggcggcgaaaactggaaagactaccgggtgcaaaaggacctgctggacccg
cagaacaacgcccaggtgatgcgcgccttcccgacggcacgcccgggcacgctgcgctcc
aaggtcctcgtgttctccaacacccgcaactccacggtcggcttcgccaaccgccagcct
ggaaccatctccctgtccttcgacgacggtgccacgtggccggtgtccaagcagttccgc
gccgcccgcaccggctacacgacgatggcgatccagcccgacggttccatcggcgtgctc
tacgagccgcagaccggcggcaaggaccagatcgggtatcagaacttcactctgagctgg
gtgactgaccagctggagtccgagccggggctgaagagcactcgcggcaccctcatcgac
ggcgccgaggcgaagctcgtgcttcccctgcgcggcaacgaccccaccctggccgacacc
atcaaggtggaaggcctgcccgaggggctgcgcttcgacgagaagacgatgaccatcgtc
ggcacgcccaaggtgggcaacaccgaccgcaagacctacccgctcaccgtgacgttcagc
gagggcgacgacggcaccggcatcccccgcgccttcaccggcacctaccagctagtgctc
aacccggagggtgccacctacggcgcccagccggcggcggtgcaggcgtcgaaccttgag
ctggccgaccacaaggccctgctcgcgctgctgcaaaagcccgagccgctgacctggctg
ttcactggtgactccatcacccacggcgtggtgcacaccaacgggctcaagcgcttcacc
gagtacttcgaggactacctgcacaccgacccgttggccggggcggatcgtcgccacgac
gtggtgctcaacaccggcgtctcctcggcgaacaccgccgatcaggccaacccgcccggg
ctgcgcaagtacgccggcccgtgggtggcagaccgcaaggcggacgtggtgttcatcacc
ttcggcatgaacgacggccgcgagtctgccgtcgccgtcgataagtaccgcgccaacctg
caagccaccatcgacgaggtccgcgcctccggggcaatcccggtgctcatgacccagaac
ttcaccaccgacccggtgaagaacaagcgcctgatcgagtacgtgaagaccggccgcgaa
ctggcggcggagaacaaggtcatgatcgtcgacttcgccggctggtgggaggagcagtcc
gacggcgcactcgtcatgcccgccatgatgaacgaccagctccacccgaaccagcagggc
cacctcgactgggcccagctcatcctctaccagctcggtctgctgaacgacggctcccgc
ctcgcccagcgagagacggcctccgccccgtcctacggcggcgcccgcctcgccctgccg
caggacaaggtggacaccaccaccctgttcggcaccagcggcgtggccacgccggccgtg
gcgcaggacctcaagggcaagaagttcgacggcaccgccaccaaggtggaatccgacaag
atctctgccttcgccggcgcgtcgacggcgaacatcaccacccggttccgcaccgagccg
ggcctgaacaccgccaccgagcacgtgctcatcaacatggccgataaggacagcaagaag
aagctcactgtggggcttcacaacaacggcattcgcgtcggcctggaccagaccggcagc
aagtacgcctacttcaccgtgccgaacctcaaggtcaccgatggcgccttccacacggtg
tccatcaacttctcccaggccgacttcgacctcttcgtcgacggcaccaaggtggccacc
aagtccctcaacggctaccgcttcgacccgaagttcttcggcatcgacaccgtctccgtc
ggcgggtcgctcaaggacctcactccgacgggcacgaagaacgcccccgcgttcgtcgac
tacgtcgagttcttctcccgggaactgactgaccaagagattgcgggcatccgcaacgag
gcggccaacaagtccgtcaccccgcagctgcgtgccctgttccacaacacgacgccgcag
atgtgggcgttcctcggcggcggcaccacccgcggcaccatggcggagatgaccgccaag
aactacgtccaggccatcgaggaagtgctgcgctgggagtcgggcaacaaggacccgatg
ctgcgcatgaagttcgtggagaacgccggcgtcgacggcgccaccgcggccacgctggtg
gaccgctaccggtcggtcgtcgccgagcagaagccggccgtcgtcgtcatcgcgccggat
gtcctcgctggcggcgccctcgtggagaaggacccggcggcgttcaaggcgcagatcgcg
gggctcatcgacgaggcgtcggctgctggctcgcaggtcctactgctcaccccgccgcag
ctgagcgaggatgccaagccctacgctgaggcgctgcgcgagctcgccaccgagaagaac
acctcgctcgtggacgcctacgcgtggctcgccgaagcagcagagatcaacggtgctgag
aaggtcaccgccgaatggttcgacggcaccgggcacatgcgcgccaagggccagctggca
ctggcgaagttcatcatggacaccatcggcctcatgccggagaacgtcaaggcctcagag
atctgggggctgaactacagcggcaacggacagcccgccaccggcgacgcccccggcttc
gccacgccgagcgccggtgagcagcaagacgacggcgccgagccgggcacccagcccgac
actccggacaccccgcagccgggtaacaagccgggtgaccagccaaacgacgagcccggc
tcccagccggacaatgacgacggcgcgaccgcgtcgctgagctccgtggcgtcgaccatc
gggcgcaccgtggtcggctggatcaccatgattatcgacgcgatccgcggcctcttcggg
atctaa

DBGET integrated database retrieval system