KEGG   Chromobacterium violaceum: CV_2424Help
Entry
CV_2424           CDS       T00147                                 

Gene name
gstA
Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
cvi  Chromobacterium violaceum
Brite
Enzymes [BR:cvi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     CV_2424 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_2 GST_N_3 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AAQ60096
LNCC_Brazil: CV2424
UniProt: Q7NVB9
LinkDB All DBs
Position
complement(2607863..2608564)
Genome map
AA seq 233 aa AA seqDB search
MIDLHYWTTPNGHKITLFLEEAGLPYRIVPVNISAGDQFQPDFLRIAPNNRIPAIVDHAP
QDGGEPISLFESGAILLYLADKTGRFIPQDLRGRNEALQWLFWQMGGLGPMAGQNHHFSQ
YAPEKLPYAIDRYVRETARLYRVLDTHLSDGRDFIAGDYSIADMACYPWIVPHQRQQQNL
DDFPSLKRWFERIAERPAVKRAYALAESVNTAPSVTEASRAILFGQDGKPRGG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatagaccttcattactggaccacgcccaacggccacaagatcaccctgttcctcgag
gaggccggcctgccttaccgcatcgtgccggtgaacatctccgccggcgatcagttccag
cccgatttcctgcgcatcgcgcccaataatcgcattccggccatcgtcgaccatgcgccg
caagacggcggcgaaccgatcagcctgttcgaatccggagccatcttgctgtatctggcc
gacaagaccggccgcttcattccgcaagacctgcgcggccgcaacgaggcgctgcagtgg
ctgttctggcagatgggcggcctggggccgatggcgggccagaaccaccatttctcccag
tacgcgccggaaaagctgccatacgcgatcgaccgctacgtgcgcgagaccgcccgcctc
taccgcgtgctggacacgcatttgtccgacggccgcgacttcatcgccggcgattactcg
atcgccgacatggcctgctacccgtggatcgtgccgcaccagcgccagcagcagaacctg
gacgacttcccttcgctcaagcgctggttcgagcgcatcgccgagcgtcccgcggtgaag
cgcgcctatgcgctggcggaaagcgtcaataccgcgccgtcggtcaccgaggcctcccgc
gccatcctgttcggccaggacggcaagccgcgcggcggctga

DBGET integrated database retrieval system