KEGG   Synechococcus sp. JA-3-3Ab: CYA_0838Help
Entry
CYA_0838          CDS       T00318                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CYA_0838 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYA_0838 (ppc)
   00680 Methane metabolism
    CYA_0838 (ppc)
Enzymes [BR:cya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CYA_0838 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(846251..849187)
Genome map
AA seq 978 aa AA seqDB search
MTSSSHLTTAERAVGSANGLKEAPPLAERDPLARALAVDEALDGRNNLLNRRLQMVEELW
EAVILQECGQPLVDLLQRLRSMCSPEGQALEYPIPEVLQIVEHLSLDAAIQTARAFALFF
QLINIVEQHYERAEDSDMRMVDSQQRTVRENEKFERLFPYLRLQGVPPGLLRRLLERLHI
RLVFTAHPTEIVRHTIREKQRAFSHLLSQLDWAEQSHPLQAQMLREQLAEEVLLWWRTDE
LHQSKPTVLNEVDYTLHYFEEVLFQAIPLLHEYLSRSLKKSFPSVEPPPAGFCNFGSWVG
GDRDGNPSVTANVTWQTARYQRNLILGKYIESVKALTKTLSVSLHWGDVDSQLLDVLEQD
RRRMPEVYESFSLQYRQEPYRLKLSYIQRRLELTRERNRNLADSACLPVPPPLDNAYANA
EEFLADLQLIQSSLKNSGLSCRQLDHLICQVQVFGFHLAHLDIRQDSSYHEAALTEIFEY
LRILPRPYSEMTEEEKTAFLLRELQTRRPLIPLEAPFSDKAAELIATFRTLRRLQQEFGM
AMCQTYVISMSRQLSDLLEVLLLAKEVGLYDPISGRGSLAVVPLFETVEDLKGAPEVLRQ
LLEIPFYRQYLAQQENLQEVMLGYSDSNKDAGFLSSNWEIYKAQQRLQAVAESYGVKLQI
FHGRGGSVGRGGGPAYEAILAQPGRSVGGRIKITEQGEVLASKYSLQDLAIFNLETVTSA
VIQASLLRTYPNDLHEWSRLMESLAERSRQVYRNLVYEQEGFVEFFHEVTPIEEISQLQI
SSRPARRSGNSKDIGSLRAIPWVFSWTQSRFLLPAWYGVGTALEEYAAKGEHNLNHLQHL
YREWPFFRMVISKVEMTLAKADLQIARHYVREMSSPERLERAMELFELIAQEMYRTREMV
LKITGHKELLENDPYLKRSVQLRNRSIVPLGFIQVSLLKRLRGKQKSHFHNTQYNRAELL
RGALLTINGIAAGMRNTG
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttcctcccacctgacgactgcagagcgggcagtgggttctgccaacggcctg
aaggaggcccctccactggcggaacgggatcccttggcccgtgccctcgccgtggatgaa
gcgctcgacggcaggaacaacctgttgaatcgccgcctgcaaatggtggaagaactttgg
gaagccgtaatcctgcaggagtgcgggcagcctttggtagatctgttgcagcggctgcgc
tccatgtgttcccctgaagggcaggccttggagtaccccatcccggaagtactacaaatt
gtcgagcatctcagccttgatgcagccattcaaacggcccgcgccttcgctttgttcttt
cagttgatcaacatcgttgaacagcactacgaacgggcagaagactcagatatgcgcatg
gtggacagccagcagcgcaccgtgcgggaaaacgaaaaatttgaacgtctgttcccttac
ctgcggcttcagggggtgccgccgggactgctgcgccggctgctggagcggctgcacatc
cgcctggtgttcaccgcccaccccaccgagatcgtccgccacaccatccgcgaaaagcaa
cgggccttctcccacttgctcagccaactggactgggcagagcagtctcaccctctgcag
gcccagatgttgagagaacaactggcggaggaggttctgctctggtggcgcaccgacgag
ttgcatcagtccaaaccgaccgttctgaacgaagtcgattacaccttgcactattttgaa
gaggttttgtttcaggctatacctctgctgcatgagtacctcagccgcagcttgaaaaag
tcctttcccagcgtcgagccaccgccggcaggcttttgcaacttcggctcgtgggtgggc
ggggatcgggacggcaacccttccgtcactgccaacgttacctggcaaacggcccgctac
cagcgcaacctgattttgggcaagtacatcgagtccgtgaaggccctcaccaaaaccctg
agcgtctctttgcactggggggatgtggacagccagttgctggatgtccttgagcaggat
cgccgccgcatgcccgaggtttacgagtccttttcgctgcaatatcgccaagagccctac
cggctcaagctcagctacatccagcggcggctggagttgacgcgggagcgcaaccgcaat
ttggccgactccgcttgcctgcctgtcccgccccctctggacaacgcctacgccaatgca
gaagaatttctggccgacttgcagcttattcagagcagcttgaaaaacagtggcctctcc
tgccgccagttggatcacctcatttgccaggtgcaggtctttggcttccatctggcccac
ctggatatccgccaagacagcagctaccacgaggccgctctcaccgagatcttcgagtac
ttgcggatcttgccgcggccctacagcgagatgacggaggaggaaaaaacagcttttctc
ctgcgggagctgcaaacccgccggcccctcatccctctagaagctcccttttccgataaa
gcggcggagctgattgccacctttcgcaccctgcgccggctgcagcaggaatttggcatg
gccatgtgccaaacctacgtgatcagcatgagccgccagttgagcgatctgttagaggtg
ctgctgctggctaaggaggtgggcctttacgatcccatcagcgggcgcggatccctggcg
gtggtgccgttgttcgagaccgttgaagacctaaagggggcgccagaggtgctgcggcag
ttgttggagatccccttctatcgccagtacctggcccagcaggaaaacctacaggaggtg
atgctgggctactcggatagcaacaaggacgctggctttctaagcagcaactgggagatc
tacaaagcccagcagcggctgcaggcggtggccgagtcctatggggtgaagttgcagatc
ttccatggccggggtggctcggtggggcgcgggggagggccggcctacgaggcgatcttg
gcccagccggggcgcagcgtggggggccgcatcaagattactgagcagggagaggtgttg
gcctctaagtactctctccaggatctggccatttttaacctggaaactgttaccagcgcc
gtcatccaggcgagcctgctgcgcacctaccccaacgacctgcacgagtggtcgcgcctg
atggaatcgctggcagagcgctctcgccaggtgtaccgcaacctggtctacgagcaggaa
ggctttgtcgagtttttccacgaggtcacccccatcgaagagatcagccaactgcagatt
agctcccgcccagctcgccgcagcggcaactcgaaagatatcggatccctgcgggccatt
ccctgggtattcagttggacacagagccgttttctcttgcccgcatggtatggagtgggc
accgctctagaggaatacgcggctaaaggcgaacacaacctcaaccacctgcagcatctc
taccgcgagtggcccttcttccgcatggtgatctccaaagtggagatgaccctggccaag
gcggatctgcaaattgcccgccactacgtgcgagagatgagctcccccgagcgcctggag
cgggcgatggagctattcgagctcattgcccaggagatgtaccgcacccgggagatggtt
ttgaaaattacaggacacaaggagctgttggagaacgacccctatctgaagcgctcggtg
caactgcgcaaccgttcaatcgtgcccctcgggtttatccaggtctcgctcctcaagcgc
ctgcgtggcaagcaaaaatcccatttccacaacacccagtacaaccgcgccgagctgctg
cggggagctctgctcaccatcaacggcatcgccgccggtatgcgcaacacaggctga

DBGET integrated database retrieval system