KEGG   Synechococcus sp. JA-3-3Ab: CYA_1194Help
Entry
CYA_1194          CDS       T00318                                 

Gene name
cbbL
Definition
(GenBank) ribulose bisphosphate carboxylase, large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cya00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CYA_1194 (cbbL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYA_1194 (cbbL)
Enzymes [BR:cya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CYA_1194 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
1207204..1208628
Genome map
AA seq 474 aa AA seqDB search
MAYSATQTKKGYQAGVKDYRLTYYTPDYTPKDTDVLACFRVTPQPGVPPEEAGAAVAAES
STGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEENQYFCFVAYPLDLFEEGSVTNMLTSIV
GNVFGFKALKALRLEDVRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLS
AKNYGRAVYEALRGGLDFTKDDENINSQPFQRWRDRYLFVMEAVHKAQAETGEIKGHYLN
VTAPTCEEMFKRAEFAKEIGAPIIMHDYLTAGFTANTSLAKWCRDNGILLHIHRAMHAVI
DRQKNHGIHFRVLAKCLRMSGGDHLHAGTVVGKLEGDRAITMGFVDLMRENYVEADRSRG
IFFTQDWASMPGVMPVASGGIHVWHMPALVEIFGDDAVLQFGGGTLGHPWGNAPGATANR
VALEACIQARNEGRDLAREGNEIIREAAKWSPELAAACELWKEIKFEFKPVDTL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtggcctactcagcaacccaaaccaaaaagggctatcaagccggcgtaaaggattaccga
ctcacgtattacacgcccgattacacgcccaaggataccgacgtcttggcctgtttccgg
gttactcctcagccgggcgttccccccgaagaggccggggcggctgtggcggctgaatct
tcgaccggcacctggacaaccgtgtggacggatctgctcaccgacttggatcggtacaag
ggccgctgctacgacatcgagccggtcccgggcgaagagaatcaatacttctgcttcgtc
gcctacccgctggatctgttcgaggaaggctcggtcaccaacatgctcacctcgattgta
ggcaacgtcttcggcttcaaagccttgaaagcgttgcggctggaggatgtgcggatcccg
gtggcctacctgaagaccttccagggccctccccacggcattcaggtggagcgggacaag
ttgaacaagtacggccgtccgctgctgggctgcaccatcaagcccaagctgggcctttcc
gccaaaaactacggacgggccgtgtacgaggcgctgcggggcgggttggacttcaccaaa
gacgacgaaaacatcaactcccagcccttccagcgctggcgggatcgctacctctttgtg
atggaggctgtccacaaggcgcaggcagagactggcgagatcaaggggcactacctgaac
gtgacggcgcccacctgtgaggagatgttcaagcgggcggagtttgccaaggagatcggt
gcccccatcatcatgcacgattacctgactgccggatttaccgccaacaccagcttggcc
aagtggtgccgcgacaacggcatcctgctgcacattcaccgtgccatgcatgccgtgatt
gaccgccagaaaaaccacggcatccacttccgggtgctggccaagtgcttgcgcatgtcc
ggcggcgaccacctgcatgccggtacggtggtgggcaagttggagggcgaccgcgccatc
accatgggctttgtggatctcatgcgggaaaactacgtggaggccgaccgctcccgcggc
attttcttcacccaagattgggcctccatgcctggggtgatgccggtggcctccggtggc
attcacgtctggcacatgccggcgctggtggagatcttcggcgacgacgcggtgctgcag
tttggtggcggaaccctgggacacccctgggggaacgcgccaggcgccactgccaaccgg
gtggccctagaagcctgtatccaggcccgcaatgagggtcgggatctggcccgtgagggc
aacgagatcatccgcgaagcggccaagtggtcgccggaactggcggctgcctgcgagctg
tggaaggagatcaagttcgagttcaagcccgtcgatacgctctag

DBGET integrated database retrieval system