KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1842Help
Entry
CYB_1842          CDS       T00319                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CYB_1842 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYB_1842 (ppc)
   00680 Methane metabolism
    CYB_1842 (ppc)
Enzymes [BR:cyb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CYB_1842 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(1928768..1931704)
Genome map
AA seq 978 aa AA seqDB search
MTSSPHLTAAEGAAGSANGLKEASLFGERDPLAHSLQVNEAFNRRNNLLNRRLQLVEELW
ESVILQECGQSLVDLLQRLRSMCSPEGQALEYPIPEVLQIIEYLSLDATIQTARAFALFF
QLINIVEQHYERAEDSDMRMVDSQQRTVRENEKFERLFPYLRAQGVPPGLLRRLLEQLHI
RMVFTAHPTEIVRHTIREKQRAFSRLLSQLDWAEQTQPLQAQMIKEQMAEEVLLWWRTDE
LHQSKPTVLNEVDYTLHYFEEVLFQAIPLLHEYLSRSLKKAFPSVEPPPAGFCNFGSWVG
GDRDGNPSVTADVTWQTARYQRNLILGKYIESVKALTKTLSISLHWGDVDSQLLDALEQD
HRLMPEVYESFSLQYRQEPYRLKLSYIQRRLELTRERNRNLADSACLPTPPPVDNAYANA
EEFLADLQLIQKSLKNSGLSCRQLDHLIQQVQVFGFHLAHLDIRQDSSYHEAALTEIFEY
LRILPRPYNEMTEEEKTAFLLQELQTRRPLIPLEIAFSEKTAELIATFRTLRRLQQEFGL
AICQTYVISMSRQLSDLLEVLLMAKEVGLYDPISGRGSLAVVPLFETVEDLKRAPEVLRQ
LLEIPFYRQYLAQQGNLQEVMLGYSDSNKDSGFLSSNWEIYKAQQRLQTVAESYGVKLQI
FHGRGGSVGRGGGPAYEAILAQPGRSVGGRIKITEQGEVLASKYSLQDLAIFNLETVTSA
VIQASLLRTYPNDLHEWSRLMESLAERSRQVYRNLVYEQEGFVEFFHEVTPIEEISQLQI
SSRPARRSGSQKDIGSLRAIPWVFSWTQSRFLLPAWYGVGTALQEYVARGEHNLNHLQHL
YREWPFFRMVISKVEMTLAKVDLQIARHYVREMSSPERLERAMELFECIAQEMHRTRTIV
LQITGHRELLENDPYLKRSVQLRNRSIVPLGFIQVSLLKRLRERQGSRTGRTRYDRAELL
RGALLTINGIAAGMRNTG
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttccccccacctgaccgctgcagagggggcagcgggttctgccaacgggctg
aaggaggcatccctgtttggggaacgggatcccttggcccattcccttcaagtcaacgaa
gccttcaaccgcaggaacaacctgttgaaccgtcgcctgcaattggtggaagaactctgg
gaatcggtgatcctgcaggagtgcggtcagtctctggtggatctgttgcagcgactgcgt
tccatgtgttccccagaaggacaagccctggagtacccgatcccagaggtactacaaatt
atcgagtacctcagcctcgacgccaccatccaaacggcacgggcctttgccctcttcttc
cagttgatcaacattgttgaacagcactacgaacgggcagaagactcggacatgcgcatg
gtggatagccaacaacgtaccgtgcgagaaaacgaaaaatttgaacggctgttcccttac
ctgcgggctcaaggggtgccgccgggcctactgcgcagattgctggagcagttgcacatt
cgcatggtttttaccgcccaccccaccgagatcgtccgccacaccatccgcgagaagcaa
cgagctttctctcgcttgctcagccaactggattgggcagaacaaacccagcctttgcag
gcccagatgataaaagaacagatggcggaagaagttttgctttggtggcgcaccgacgag
ttgcatcagtccaagccgactgttttgaacgaagtcgattacactttgcactattttgaa
gaggtgttgtttcaggccatccccctgctgcacgagtacctcagccgcagcctgaaaaaa
gcttttcccagcgtcgagccaccgccggcaggattttgcaacttcggctcgtgggtaggc
ggggatcgggatggcaacccttccgtcaccgccgatgttacctggcaaacggctcgctat
cagcgcaacctcatcctgggcaagtacatcgaatcggtgaaggctcttaccaaaaccttg
agcatttccctgcactggggggatgtggacagccaactgctggatgcccttgagcaggat
caccgcctcatgcctgaggtttacgaatcgttttcgctgcaataccgccaagagccctac
cgcctcaagctcagctacattcagcggcggctggagttgacgcgggagcgcaatcgcaac
ttggccgactccgcttgtttgcccacccctccccctgtggacaacgcctatgccaacgca
gaagaatttctggccgacttgcagcttatccagaaaagcttgaaaaacagcggcctttcc
tgccgtcagttggatcatctcattcaacaggtacaggtgtttggctttcacctggcccat
ctggatatccgccaagacagcagctaccacgaagccgctctcacggagattttcgagtac
ttgcgcattttgccgcgtccctacaacgagatgacggaagaggaaaaaaccgcctttctc
ctgcaggagctacaaacacgtcggcctctgataccgctggagatcgccttttccgagaaa
acggcagagctgatcgccacctttcgcaccctgcgccgcctgcagcaggaattcggcttg
gccatttgccagacctatgtgatcagcatgagccgccagttaagcgacctgttggaggtg
ctgctgatggccaaggaggtgggtctctacgatcccatcagtggtcgcggatccctggcg
gtggtgccgctgtttgagaccgtcgaagacctgaagcgggccccggaagttttgcggcag
ttgctggagatccctttctatcgccagtacttggctcagcaggggaatctacaggaggtg
atgctgggctactccgatagcaacaaagattccggctttttgagcagcaactgggagatt
tacaaggctcaacaacgcctgcagacggtggccgaatcctacggggtgaagctgcagatc
ttccatggccggggcggttcggtgggccgtggagggggcccggcttacgaggccatcttg
gctcagccagggcgcagtgtggggggccgcatcaaaattaccgaacagggagaggtgttg
gcctccaagtattccctccaggatctggccatttttaacctggaaaccgtcaccagcgcc
gtgatccaggccagcctactgcgcacctaccccaacgatctgcacgagtggtcgcgcctg
atggaatccttggcggagcgctcccggcaggtgtaccgtaacctggtctacgagcaggag
ggctttgtggagtttttccacgaggtcacccccattgaagagatcagccaactgcagatc
agctcccgtcccgcccgccgcagcggtagccaaaaagacatcggatccctgcgggccatt
ccctgggtattcagttggacgcaaagccgctttctcttgccggcctggtatggggttggc
accgccctacaagaatacgtggccaggggcgagcacaacctcaaccacctgcagcacctc
tatcgcgaatggcctttcttccgcatggtgatctccaaagtggagatgactctggccaaa
gtggatctgcaaatagcgcgtcactacgtgcgggagatgagctctccagagcgtctagag
cgggcgatggagctgtttgagtgtattgcccaagaaatgcaccgtactcgcacaatagtg
ttgcagattacgggccacagggaactgttggagaacgacccttatttgaagcgctcggtg
cagttgcgcaaccgctctattgtgcccttgggctttattcaagtctctctcctcaagcgc
ctgcgggagcgtcagggatcccgcaccggacgaacacgctacgaccgagctgaacttctg
cgtggggctctgctcaccatcaacggcattgccgccgggatgcgcaacacgggctga

DBGET integrated database retrieval system