KEGG   Cyanothece sp. PCC 7424: PCC7424_3532Help
Entry
PCC7424_3532      CDS       T00808                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PCC7424_3532
Enzymes [BR:cyc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PCC7424_3532
Transporters [BR:cyc02000]
 Other Transporters
  Pores ion channels [TC:1]
   PCC7424_3532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3933488..3934141)
Genome map
AA seq 217 aa AA seqDB search
MLKLYHTPVSPNSHRVWVTLIEKGLEFELVEVNLTGEQFKPEFLAMNPFHHIPVLVDDDN
TIIESLAILDYLEAKYPTPAMLPDNPKDLSTVRMVQLVTVNELLPSASPLFPVMLGLSKG
DEEKIKQAKEKVGTIFKFFESLLDERPFFGSETITLADAVAGTVVPWLPRAGVPLTDYSK
LNRWCDRILSRPAWEQTKATPEAMEQIKSAMAARMSS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagctttatcatactcctgtatctcctaattctcatcgagtttgggtgactctt
atagaaaaagggttagagtttgagttagtcgaagttaatttaacgggggaacagtttaaa
cctgaatttttagcgatgaatccttttcatcatattcccgttttagtagatgatgacaat
actattatagaatctttagcaattttagattatttagaggcaaaatatcctaccccggca
atgttacctgataatcctaaagatttatcaacggtaagaatggtacagctagtcacggtt
aatgagttattaccctcagcctcccctttatttccggttatgttaggtttatcaaaggga
gatgaagaaaagataaaacaagccaaagaaaaagtcggaacaatttttaagttttttgaa
agtttattagatgagcgcccattttttggcagtgaaactattactttagctgatgctgtt
gccggaacagttgttccttggttgcccagggccggtgtacctttaactgattattctaaa
ttaaataggtggtgcgatcggattttatctcgtccagcttgggaacaaaccaaagctacc
ccagaagcgatggaacagattaaatcggctatggcggcgcggatgtcatcctaa

DBGET integrated database retrieval system