KEGG   Cyanothece sp. PCC 7424: PCC7424_4238Help
Entry
PCC7424_4238      CDS       T00808                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCC7424_4238
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PCC7424_4238
   00680 Methane metabolism
    PCC7424_4238
Enzymes [BR:cyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PCC7424_4238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4701113..4704178
Genome map
AA seq 1021 aa AA seqDB search
MSSLVQVSTTPLQFFSTSDLFLQDRLKLVEELWEEVLQAECGQELVALLKKLRAICCEQG
QAQKALEDSITQLIEQLDLVEAVRTSRAFALYFQLINIVEQHYEQRDQQLSRRATYQESP
VKTKNGNNSESPSLFSSAFGANWVERSWTDDNQNQQKAGTLHWLFPYLKQLNVPPQQIQR
LLNQLDIRLVFTAHPTEIVRHTIRRKQRRIAHILQKLDQAEETFRGMGLTNSWEAEQLKE
QFKEEIRLWWRTDELHQFKPTVLDEVDYALHYFNEVLFQALPQLALRLKQTLKGAFPRLE
PPKNNFCYFGSWVGGDRDGNPFVTPEVTWATACYQRNVVIEKYLQTVDELSNILSPSLHW
CNVLPDLLDSLEKDRVQMPEIYTQLAIRYRQEPYRLKLAYIKKRLENTQDRNNRLANPNE
RLLIFKTGNPNIYHNKEELSEELQLIRRNLEASGLTCQELENLICQVEIYGFNLTQLDFR
QESSCHSDAINEIAEYLQILPKPYNQLSEAERTAWLIEELKTRRPLIPQEMPFSEKTCEV
IETLKMLRLLQQEFGLEICHTYIISMTNDVSDVLEVMLLAQEAGLYDPATSSITIRIVPL
FETVEDLKRAPEIMRALFEMTLYRAALAGGYQYLAKDQGQEIIGELQPPLLQPPNLQEIM
VGYSDSNKDSGFLSSNWEIHKAQKALQKVAKGYGIDLRLFHGRGGSVGRGGGPAYAAILA
QPTGTINGRIKITEQGEVLASKYSLPELALYNLETIVTAVIQSSLLGCGFDDIQVWNEIM
EDLAGCARKAYRSLIYEDPDFIDFFMSVTPIPEISQLQISSRPARRKSGKKDLSTLRAIP
WVFSWTQTRFLLPAWYGVGTALEQFINREPEEHLKLLRYFYLKWPFFRMVISKVEMTLSK
VDLQIAHHYVKELSKPEDLERFERVFNQISEEYHRTCRLVLDITENERLLDGDPTLQRSV
QLRNGTIVPLGFLQVSLLKRLRQYNAQAESGVIHFRYSKEELLRGALLTINGIAAGMRNT
G
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgagttccctagttcaagtatccacaacccccttacaatttttctctacctccgatcta
tttttacaagacagactgaagttagttgaagaactatgggaagaagtgctacaggctgaa
tgtggtcaagagttagtcgctctgctcaaaaagttaagagcaatttgttgtgagcaagga
caagcccaaaaagctctagaagattccataacccaactgatagaacaactagacctcgtt
gaagccgtcagaacatctcgcgcttttgctctttatttccaactgattaacatcgtagaa
caacactacgaacaacgagatcaacaactctccagacgggcaacctatcaagaaagcccc
gtaaaaaccaaaaatggcaataattccgagtctccgagtttattttcctcggcatttgga
gcaaattgggtagaaagaagttggacagatgacaaccaaaaccaacaaaaagccggaacc
cttcactggctctttccctatttaaaacaactcaatgttccccctcaacaaatccaacgg
cttctaaatcaactcgatattcgtctggtttttacagcccatcccaccgaaattgtccgg
cacaccatccgacgcaaacaacgccggatcgcccatatcttacaaaaactcgaccaagca
gaagaaacctttcgaggtatggggttaaccaactcttgggaagccgaacaattaaaagaa
cagtttaaagaagaaattcgtctctggtggcggacagacgaactacatcaatttaaaccc
accgttttagacgaagtggattatgccctacactactttaatgaagttctgtttcaagct
ctgcctcaattagccctccgtctcaaacaaaccttaaagggtgcttttccccgactagaa
cccccgaaaaataatttctgttattttggctcttgggtaggaggcgatcgagatggaaac
ccgtttgtcactccggaagtcacttgggcaaccgcctgttatcagcgaaacgtggtcatc
gaaaaatatctgcaaaccgttgatgagttatcgaacattttaagtccgtctctccattgg
tgtaatgtgttgccggacttgctcgactctttagaaaaagaccgggtacaaatgccggag
atttatactcaattggccatccgctaccgtcaagaaccctatcgtctcaaattagcctac
attaaaaaacggctcgaaaacacccaagatcgtaacaaccgtctagcgaaccccaatgag
cgcctattaatcttcaaaaccggcaatccgaatatttatcataataaggaagaattgagc
gaagaacttcaattaatccgccgaaacttagaagccagtgggttaacctgtcaggaattg
gaaaatttaatctgtcaggtggaaatttacgggtttaacctcactcaactcgatttccgt
caagaatctagttgtcattctgacgcaattaatgaaattgccgagtatttacaaatccta
cccaaaccctataaccaactgagtgaagcagaaagaaccgcttggctgatagaagaatta
aaaacccgtcggcctctgattccccaggaaatgcccttttctgagaaaacctgcgaagtc
attgaaaccttaaaaatgttgcgactgctgcaacaggaatttggcttagagatctgtcat
acctacattatcagtatgaccaatgatgtgagtgatgtgttagaagtgatgctattagca
caagaagccggactctatgatccagccacaagctctatcaccattcgcattgttccccta
tttgaaaccgtagaagacttgaaacgcgctccggaaattatgcgggcgctgtttgaaatg
accctttaccgagccgctttggccggaggatatcaatatttagcgaaagatcaaggtcaa
gagatcattggggaactccaaccccccctactccaaccccccaaccttcaagaaattatg
gtcgggtattccgacagtaacaaagattcaggctttttaagcagtaattgggaaattcat
aaagcccaaaaagccctacaaaaagtcgccaaaggatatggaattgacctacgactgttt
catggtcgaggcggttcagtcggacgaggaggcgggccagcttatgccgctattctcgcc
caacccacaggaacaattaacggacgcattaaaattaccgaacagggagaagtgttagct
tctaaatattctttacccgaattagccctgtataatttagaaacgatcgtcacggcggta
attcaatcgagtttattggggtgtgggtttgatgatattcaagtctggaatgaaatcatg
gaagacttagccggttgcgctcgtaaagcttaccgttccttgatttatgaagacccagat
tttatcgatttcttcatgtctgtgactcccattccagaaattagtcaactgcaaattagt
tcccgtccggctcgacgcaaaagtggcaaaaaagatttgagtaccttacgggctattcct
tgggtatttagttggactcaaacccgttttctgctgccggcttggtatggagtaggaacg
gctttagagcaatttattaatcgagaaccagaagaacatttaaaattattgcgctatttt
tatttaaaatggccgttctttagaatggtaatttctaaagtcgagatgaccttatctaag
gtagatttacaaattgcccatcattatgtaaaagaactctctaaacccgaagatctagag
cggtttgaacgagtctttaatcaaatttccgaagaatatcatcggacttgtcgtttagtt
ttagacattacagaaaatgaacgattacttgatggtgatcccacattacaacgatctgtc
cagttaagaaatggcacaattgtccccttgggatttttacaagtttcgttattaaaacgg
ctacgtcagtataacgctcaagcggagtcgggggtcattcatttccgttattctaaggaa
gaattattaagaggagcgctcttaaccattaatggaattgcagccggaatgcggaatacc
ggttga

DBGET integrated database retrieval system