KEGG   Cyanobium sp. NIES-981: CBM981_1832Help
Entry
CBM981_1832       CDS       T04888                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cyi  Cyanobium sp. NIES-981
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBM981_1832 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CBM981_1832 (ppc)
   00680 Methane metabolism
    CBM981_1832 (ppc)
Enzymes [BR:cyi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CBM981_1832 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:1624997..1627963
Genome map
AA seq 988 aa AA seqDB search
MRQLVPSVVEPSPRATRLLGERMELVEDLWQTVLRSECPPHHAERLLRLKQLSDPTEGDT
ATVDNGAAIVQLIREMDLAEAIAAARAFSLYFQLVNILEQHIEEDSYLDSLKTLPEPVSS
DPFLPPLASQTEPATFRQLFERLRNLNVPPAQIENLLRNLDLRLVFTAHPTEIVRHTVRH
KQRRVATLIQKLEQGSGLNRVERQSLRLQLEEEIRLWWRTDELHQFKPTVLDEVDYALHF
FQEVLFEAMPLLRQRVSAALAESYPDVEPPRDAFCTYGSWVGADRDGNPSVTPDITWRTA
CFQRQLMLERYVKAVGELRDQLSISMQWSQVSPALLESLEMDRLRFPEIYEERAARYRLE
PYRLKLSYVLERLRLTQERNQLLADAGWESPCDGLASTAPVLGGLGGGAGLQELHYAAVD
EFRNDLELVLQSLEGTGLSCESLQHLISQVQIFAFCLASLDIRQESTRHSDALDELSRYL
QLPVPYGEMDEEQRVAWLLGELQTRRPLFPPAASWSAATTETFAVLRMVQRLQQEFGTRI
CSTYVISMSHTVSDLLEVLLLAKEAGLVDPVAQSSSLLVVPLFETVEDLQGAPAVMGQLF
SQPFYRRLLATSDASQPLQEVMLGYSDSNKDSGFLSSNWEIHKSQIALQQLATQHDVALR
IFHGRGGSVSRGGGPAYQAVLAQPSGTLSGRIKITEQGEVLASKYSLPELALYNLETLTT
AVLQNSLVSTPVDNTPTWNELMGRLAARSRDFYRALVHDNPDLVAFFQQCTPIEEISKLQ
ISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGAALREELDHDPEQLELLRL
LYQRWPFFRMLISKVEMTLSKVDIDLAHHYVQALGRPERREAFEQIFQTIAAEFDLTRDL
VLAITGHQRLLDGDPALQLSVDLRNRTIVPLGFLQVALLRRLRDQNRQPPMREATGSGSD
GRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgcggcagttggtgccttccgtcgttgaaccttcccctcgcgccacccgtctgctcggt
gagcggatggagctggtcgaagacctgtggcagaccgtgctccgcagcgagtgccctccg
caccatgccgagcggctgcttcgcctgaaacagctgagtgatcccacggagggcgacacc
gccaccgtcgacaacggcgccgccatcgtgcagctgatccgcgagatggatctggccgaa
gcgattgcggctgcccgggccttctccctctatttccagctggtcaacatcctcgaacag
cacatcgaggaggacagctacctcgacagcctcaagaccctccccgagcctgtctcgagc
gaccctttcctgccgccgctggccagccagaccgagccggccacgttccgccagctgttc
gagcggctccgcaacctcaacgtgccgccggcccagatcgagaacctgctgcggaatctc
gatctgcgcctggtgttcacggcccatcccaccgagatcgtgcgccacaccgtgcgccac
aagcagcggcgggtggccacgttgattcagaagctggagcagggctccggcctgaaccgg
gtggaacggcagagcctccgcctgcagctggaggaggagatccgcctctggtggcgcacc
gatgaactgcaccagttcaagcccaccgtgctcgatgaggtggattacgccctgcacttc
ttccaggaggtgctgttcgaggccatgcccctgctgcggcagcgggtgagcgccgccctg
gcggagagctaccccgatgtggagcctccccgcgacgcgttctgcacctacggctcctgg
gtgggggccgaccgggatggcaatccttcggtcacgccggacatcacctggcgcacggcc
tgtttccagcgccagctcatgctggagcgctacgtcaaggccgtgggtgagctgcgggac
cagctcagcatctccatgcagtggagccaggtgagtccagcgctgctggaatcgctcgag
atggaccggctccgctttcccgagatctacgaggaacgggccgcccgctaccgcctcgag
ccctaccgcctcaagctgagctacgtgctcgagcggttgcgcctcacccaggaacgcaac
cagctgctggccgacgccggctgggagtccccctgcgacggactcgcctccaccgcgccg
gtgctgggcggtctgggggggggcgccggccttcaggagctccactacgcggcggtggat
gagttccgcaacgatctggaactggtgctccagagcctggagggcacggggctcagctgt
gaatcgctgcagcacctgatcagccaggtgcagatctttgccttctgcctcgccagcctg
gacatccgccaggagagcacccgccacagcgacgcgctcgatgagctgagccgctacctg
cagctgcccgttccctacggcgaaatggacgaggagcaacgggtggcctggctcctgggg
gagctgcagacccgccgccccctcttcccgcccgccgccagctggagcgctgccaccacc
gagaccttcgcggtgctgcggatggtgcaacggctgcagcaggagttcggcacccgcatc
tgcagcacctacgtgatctccatgagtcacacggtgtccgatctgctggaggtgctgctg
ctggccaaggaggcgggcctggtggatccggtggcccagagttccagcctgctggtggtg
cccctgttcgaaacggtcgaggacctgcagggggccccggcggtgatggggcagctgttc
agccagcccttctaccggcgcctgctcgccaccagtgacgccagccaaccgctccaggaa
gtgatgctgggctattccgacagcaacaaggattccggcttcctctccagcaactgggag
atccacaagtcccagatcgcgctgcagcagctcgccacccagcacgacgtggcgctgcgc
atcttccacggccgcggcggctcggtgagccgcggcggcgggccggcctaccaggcggtg
ctggcccagcccagcggcaccctgagcggccggatcaagatcaccgaacagggggaggtg
ctggcctccaagtactccctgcccgagctggccctctacaacctcgagaccctcaccacg
gccgtgctgcagaacagcctggtgagcaccccggtggacaacacccccacctggaacgag
ctgatggggcgcctggcggcccgctcccgcgacttctaccgcgccctggtgcacgacaac
cccgatctggtggccttcttccagcaatgcaccccgatcgaggagatcagcaagctgcag
atctccagccggccggcccgccgcaagagcggtgccaaggacctctccagcctgcgggcc
atcccctgggtgttcggctggacccagagccgcttccttctgcccagctggttcggggtg
ggggccgctctgcgcgaggagctcgaccacgaccccgagcaactggagctgctgcggctg
ctctaccagcgctggccgttcttccggatgctgatctccaaggtggagatgaccctctcc
aaggtggacatcgacctggcccatcactacgtgcaggccctgggccggccagagcggcgc
gaagccttcgagcagatcttccagaccatcgccgcagagttcgatctgacccgcgatctg
gtgctggccatcaccggccatcagcggctgctcgatggcgatccggccctgcagctctcg
gtggatctgcgcaaccgcacgatcgttcccctgggcttcctgcaggtggccctgctgcgc
cggctgcgggaccagaaccggcaaccacccatgcgcgaagctacgggaagcggttccgat
ggccgcacctacagccgcagtgaactgctgcggggtgccctgctcaccatcaacggcatc
gctgccggcatgcgcaacaccggctga

DBGET integrated database retrieval system