KEGG   Cyanothece sp. PCC 7822: Cyan7822_2901Help
Entry
Cyan7822_2901     CDS       T01310                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00630  Glyoxylate and dicarboxylate metabolism
cyj00710  Carbon fixation in photosynthetic organisms
cyj01100  Metabolic pathways
cyj01120  Microbial metabolism in diverse environments
cyj01200  Carbon metabolism
Module
cyj_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cyj_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cyj_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyj00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan7822_2901
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7822_2901
Enzymes [BR:cyj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cyan7822_2901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ADN14859
JGI: Cyan7822_2901
UniProt: E0U7P7
LinkDB All DBs
Position
3225879..3226214
Genome map
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQIVKQIQYILDQGFIPAVEFEENPKPTDHYWTLWKLPL
FSASTPQDVLAEVRECRSEYPSYYIRVIGFDNIKQCQTMSFIVHKPNTGRF
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacctaaagagcgtcgttacgaaactctctcttacttaccccctctaacc
gatcagcaaatcgttaagcaaatccaatatattttggatcaagggtttattcctgccgtt
gaatttgaagaaaatcccaagcctactgatcactactggactctgtggaagctgccttta
tttagcgcttctactcctcaagatgttttagctgaagttcgggaatgtcgttctgagtat
cctagctactacattcgcgtgattggatttgacaatatcaaacaatgtcaaaccatgagc
tttatcgttcacaagcctaacactggtcgtttctaa

DBGET integrated database retrieval system