KEGG   Cyanothece sp. PCC 7425: Cyan7425_2220Help
Entry
Cyan7425_2220     CDS       T00836                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00620  Pyruvate metabolism
cyn00680  Methane metabolism
cyn00710  Carbon fixation in photosynthetic organisms
cyn01100  Metabolic pathways
cyn01120  Microbial metabolism in diverse environments
cyn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cyan7425_2220
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7425_2220
   00680 Methane metabolism
    Cyan7425_2220
Enzymes [BR:cyn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cyan7425_2220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACL44581
JGI: Cyan74252220
UniProt: B8HVC9
LinkDB All DBs
Position
complement(2135997..2139053)
Genome map
AA seq 1018 aa AA seqDB search
MTSTVPLSEQDQILSNRREQALRNRMQVIEDLLEAVLQTECGQTLVDLLRQLRALCSPEG
QVRRALDEEVLRLIEKLDFNEAIRAARSFALYFQLINIVEQHYEQQESLYRTHPESGHPL
PDLISHISGESFPDKSFSGQNFSAHNNTVDVRGGLTERVEHSLYEATSLERHQGTFAWLF
PHLWQQNVPPRYLQNLIDQLDIKLVFTAHPTEIVRQTIRDKQRRIARILEQLDRVEATLG
SRSGVEMQNLHEQLIEEIRLWWRTDELHQFKPQVLDEVEYSLHYFKEVVFEIIPQLYRRI
TQSLQQSFPNLRPPRHNFCKFGSWVGADRDGNPSVTPEVTWETACYQRDLVLEKYTKSVE
KLINVLSLSLHWCDVLPDLLDSLEQDQQQFPELYEQLSARFRHEPYRFKLSYVLRRLENT
RDRNRQLQNGYYPFSTDSSGYGDLQIYRKGEEFLAELLLIQRNLQATNLSCRQLEDLICQ
VEIFGFNLAQLDIRQESSCHSEALNEIITYLQILPRPYNELSEGERTEWLVKELQTRRPL
IPAELPFSERTREIIETLRMVRRLQQEFGPDICKTYVISMSHEASDLLEVLLLAKEAGLY
DPVTGTGNLQVVPLFETVEDLKKAPTVLTQLLELPFYRAYLDSDCPSADVPPLQEVMLGY
SDSNKDSGFLSSNWEIYKAQQSLQHTAERYGVALRIFHGRGGSVGRGGGPAYAAILAQPG
RTIDGRIKITEQGEVLASKYSLPELALYNLETITTAVIQASLLRTSIDEIQPWHEIMEEL
ALRSRQHYRQLIYEQPDFVDFFHQVTPIEEISQLEISSRPSRRGGKRTLTSLRAIPWVFS
WTQSRFLLPAWYGVGTAIQDFLAEKPVEHLSLLQYFYFKWPFFRMVISKAEMTLAKVDLQ
IAQHYVRELTHPEDRERFAPLYDQIAQEYYRTCELILTITGHKRLLDGDPDLQRSVQLRN
GNIVPLGFLQVLLLKRLRQHQSQTSSGALLRSRYSKGELRRGALLTINGIAAGMRNTG
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgacttctaccgttcccctctctgaacaggatcaaattctttccaaccggcgtgagcaa
gctctccgcaatcggatgcaggtgattgaagacctgttagaagcggttctgcaaacggaa
tgtggtcagacccttgtagatctgctccggcaattacgggccctctgttctcccgaaggt
caggtgagacgggccctggatgaagaagtgctccggttgatcgaaaagctggacttcaat
gaagcgattcgggcggcccgttcctttgccctctacttccaactgatcaatattgttgag
cagcactacgagcaacaggaaagcctgtaccgtacccatccagaatcgggacatcccctc
ccagatttgatttcccatatcagtggcgagagcttcccagacaaaagtttttctggacag
aacttttcggcacacaataatacagtcgatgtccggggtggtctaacagagcgggtcgaa
catagtctttacgaagccacctctttggagcgtcatcagggtacctttgcctggctgttc
ccccatctctggcaacagaatgttcccccccgttatctccaaaatctgatcgatcaactg
gatatcaagctggtctttacggctcacccaaccgaaattgtgcggcagacgatccgggat
aaacagcggcggattgctcgaatcctggaacaactggatagggtggaggcaaccctgggc
agtcgcagtggggtggagatgcaaaacctgcatgagcagctcatcgaagaaattcggctc
tggtggcgaaccgatgaattacaccagttcaaaccccaggttttagatgaggtggaatac
agcctgcactactttaaggaagtggtgttcgagattattccccagctttaccgccgcatc
acccaatctctccaacagtctttccctaatttgcggccaccccggcataatttctgtaaa
tttggttcctgggtgggggccgatcgcgacggcaacccgtctgtgaccccagaggtgacc
tgggaaaccgcctgctaccaacgggatctggtcctggagaagtatactaagtcggttgaa
aaactgatcaatgtcctcagcttgtcgctgcactggtgtgatgtgctgccggatctgctg
gattcattggaacaggatcaacaacaattccccgaactctatgagcagctatctgcgcgc
tttcgccatgagccctatcgcttcaagctttcttatgttttaaggagactagagaatacc
cgcgatcgcaaccggcaactgcagaatggctactatcccttttcgacggatagttcaggg
tatggggacctacagatttaccgtaagggcgaggaatttctggcggaattgttgctgatt
caacgcaatctgcaggccactaatctcagttgtcggcaactggaagatttaatttgccag
gttgagatctttggctttaatttagcccagctcgatatccgtcaggaaagttcctgtcat
tctgaagcactgaatgaaatcattacctatttgcaaattctccctcgcccctacaatgag
ctgagtgagggggagcggaccgagtggctggtgaaggaacttcagacccggcggcccttg
attccggcagagttgccctttagtgagcgcacccgtgagatcattgaaaccctgcgcatg
gtgcggcggctccagcaagagtttggcccggacatctgcaaaacctacgtgatcagcatg
agccatgaggccagtgatttgctggaagtgctgctgctggcgaaggaggctggtctatac
gatccggttacaggaacagggaatctgcaggtggtgccgctgtttgaaaccgttgaagac
ttgaaaaaagcccccactgtgctgacccaactcctggagttgcccttttatcgcgcttac
ctggatagtgattgccccagtgccgatgttccacctttacaggaagtgatgttgggttat
tccgacagcaataaggattctggcttcttgagcagcaattgggaaatttataaagcccag
caatccctgcagcacacagcggaacggtatggtgtggccctgcggatcttccacggtcgg
ggcggctctgtgggacggggagggggcccagcctatgcagctatcctggcccaaccagga
cgaacgatcgatgggcggatcaagattactgaacagggggaagtgctggcctctaagtat
tctctgccagaactggccctctataatctggaaacgattacgactgcagtgattcaagcc
agtttactccgcaccagtattgatgaaattcagccctggcacgagatcatggaggagctg
gccctgcgatcgcggcagcactaccggcagctgatctacgaacaaccggattttgtcgat
ttctttcatcaggtcaccccgatcgaagagatcagccagttagaaatcagttctcgcccc
agccggcggggaggcaagcgaaccctgaccagcctgcgggccattccctgggtgtttagc
tggacacagagtcgttttcttctcccggcctggtacggggtaggcaccgccatccaggac
tttttggccgaaaagccggtcgagcatctttctctgctgcagtatttctatttcaaatgg
ccctttttccgcatggtgatttctaaggcagaaatgaccctggccaaggtagacctgcaa
attgctcagcattacgtgcgggaattgacccacccagaagatcgagaacgctttgccccc
ctctatgaccaaattgcccaggaatattaccgcacctgcgagttaattctgaccattacc
gggcataagcgactcctggatggagatcccgatttacagcgatcggtacagctccgcaat
ggtaacattgtccccctcggctttctccaggttttattactcaaacgactgcggcaacac
cagagccaaaccagttctggggcgttattgcgatcgcgctacagtaagggcgaactgcgt
cgaggtgcgttgttaacgattaatggcattgccgccgggatgcgaaacacaggttaa

DBGET integrated database retrieval system