KEGG   Cyanothece sp. PCC 7425: Cyan7425_2220Help
Entry
Cyan7425_2220     CDS       T00836                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cyan7425_2220
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7425_2220
   00680 Methane metabolism
    Cyan7425_2220
Enzymes [BR:cyn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cyan7425_2220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2135997..2139053)
Genome map
AA seq 1018 aa AA seqDB search
MTSTVPLSEQDQILSNRREQALRNRMQVIEDLLEAVLQTECGQTLVDLLRQLRALCSPEG
QVRRALDEEVLRLIEKLDFNEAIRAARSFALYFQLINIVEQHYEQQESLYRTHPESGHPL
PDLISHISGESFPDKSFSGQNFSAHNNTVDVRGGLTERVEHSLYEATSLERHQGTFAWLF
PHLWQQNVPPRYLQNLIDQLDIKLVFTAHPTEIVRQTIRDKQRRIARILEQLDRVEATLG
SRSGVEMQNLHEQLIEEIRLWWRTDELHQFKPQVLDEVEYSLHYFKEVVFEIIPQLYRRI
TQSLQQSFPNLRPPRHNFCKFGSWVGADRDGNPSVTPEVTWETACYQRDLVLEKYTKSVE
KLINVLSLSLHWCDVLPDLLDSLEQDQQQFPELYEQLSARFRHEPYRFKLSYVLRRLENT
RDRNRQLQNGYYPFSTDSSGYGDLQIYRKGEEFLAELLLIQRNLQATNLSCRQLEDLICQ
VEIFGFNLAQLDIRQESSCHSEALNEIITYLQILPRPYNELSEGERTEWLVKELQTRRPL
IPAELPFSERTREIIETLRMVRRLQQEFGPDICKTYVISMSHEASDLLEVLLLAKEAGLY
DPVTGTGNLQVVPLFETVEDLKKAPTVLTQLLELPFYRAYLDSDCPSADVPPLQEVMLGY
SDSNKDSGFLSSNWEIYKAQQSLQHTAERYGVALRIFHGRGGSVGRGGGPAYAAILAQPG
RTIDGRIKITEQGEVLASKYSLPELALYNLETITTAVIQASLLRTSIDEIQPWHEIMEEL
ALRSRQHYRQLIYEQPDFVDFFHQVTPIEEISQLEISSRPSRRGGKRTLTSLRAIPWVFS
WTQSRFLLPAWYGVGTAIQDFLAEKPVEHLSLLQYFYFKWPFFRMVISKAEMTLAKVDLQ
IAQHYVRELTHPEDRERFAPLYDQIAQEYYRTCELILTITGHKRLLDGDPDLQRSVQLRN
GNIVPLGFLQVLLLKRLRQHQSQTSSGALLRSRYSKGELRRGALLTINGIAAGMRNTG
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgacttctaccgttcccctctctgaacaggatcaaattctttccaaccggcgtgagcaa
gctctccgcaatcggatgcaggtgattgaagacctgttagaagcggttctgcaaacggaa
tgtggtcagacccttgtagatctgctccggcaattacgggccctctgttctcccgaaggt
caggtgagacgggccctggatgaagaagtgctccggttgatcgaaaagctggacttcaat
gaagcgattcgggcggcccgttcctttgccctctacttccaactgatcaatattgttgag
cagcactacgagcaacaggaaagcctgtaccgtacccatccagaatcgggacatcccctc
ccagatttgatttcccatatcagtggcgagagcttcccagacaaaagtttttctggacag
aacttttcggcacacaataatacagtcgatgtccggggtggtctaacagagcgggtcgaa
catagtctttacgaagccacctctttggagcgtcatcagggtacctttgcctggctgttc
ccccatctctggcaacagaatgttcccccccgttatctccaaaatctgatcgatcaactg
gatatcaagctggtctttacggctcacccaaccgaaattgtgcggcagacgatccgggat
aaacagcggcggattgctcgaatcctggaacaactggatagggtggaggcaaccctgggc
agtcgcagtggggtggagatgcaaaacctgcatgagcagctcatcgaagaaattcggctc
tggtggcgaaccgatgaattacaccagttcaaaccccaggttttagatgaggtggaatac
agcctgcactactttaaggaagtggtgttcgagattattccccagctttaccgccgcatc
acccaatctctccaacagtctttccctaatttgcggccaccccggcataatttctgtaaa
tttggttcctgggtgggggccgatcgcgacggcaacccgtctgtgaccccagaggtgacc
tgggaaaccgcctgctaccaacgggatctggtcctggagaagtatactaagtcggttgaa
aaactgatcaatgtcctcagcttgtcgctgcactggtgtgatgtgctgccggatctgctg
gattcattggaacaggatcaacaacaattccccgaactctatgagcagctatctgcgcgc
tttcgccatgagccctatcgcttcaagctttcttatgttttaaggagactagagaatacc
cgcgatcgcaaccggcaactgcagaatggctactatcccttttcgacggatagttcaggg
tatggggacctacagatttaccgtaagggcgaggaatttctggcggaattgttgctgatt
caacgcaatctgcaggccactaatctcagttgtcggcaactggaagatttaatttgccag
gttgagatctttggctttaatttagcccagctcgatatccgtcaggaaagttcctgtcat
tctgaagcactgaatgaaatcattacctatttgcaaattctccctcgcccctacaatgag
ctgagtgagggggagcggaccgagtggctggtgaaggaacttcagacccggcggcccttg
attccggcagagttgccctttagtgagcgcacccgtgagatcattgaaaccctgcgcatg
gtgcggcggctccagcaagagtttggcccggacatctgcaaaacctacgtgatcagcatg
agccatgaggccagtgatttgctggaagtgctgctgctggcgaaggaggctggtctatac
gatccggttacaggaacagggaatctgcaggtggtgccgctgtttgaaaccgttgaagac
ttgaaaaaagcccccactgtgctgacccaactcctggagttgcccttttatcgcgcttac
ctggatagtgattgccccagtgccgatgttccacctttacaggaagtgatgttgggttat
tccgacagcaataaggattctggcttcttgagcagcaattgggaaatttataaagcccag
caatccctgcagcacacagcggaacggtatggtgtggccctgcggatcttccacggtcgg
ggcggctctgtgggacggggagggggcccagcctatgcagctatcctggcccaaccagga
cgaacgatcgatgggcggatcaagattactgaacagggggaagtgctggcctctaagtat
tctctgccagaactggccctctataatctggaaacgattacgactgcagtgattcaagcc
agtttactccgcaccagtattgatgaaattcagccctggcacgagatcatggaggagctg
gccctgcgatcgcggcagcactaccggcagctgatctacgaacaaccggattttgtcgat
ttctttcatcaggtcaccccgatcgaagagatcagccagttagaaatcagttctcgcccc
agccggcggggaggcaagcgaaccctgaccagcctgcgggccattccctgggtgtttagc
tggacacagagtcgttttcttctcccggcctggtacggggtaggcaccgccatccaggac
tttttggccgaaaagccggtcgagcatctttctctgctgcagtatttctatttcaaatgg
ccctttttccgcatggtgatttctaaggcagaaatgaccctggccaaggtagacctgcaa
attgctcagcattacgtgcgggaattgacccacccagaagatcgagaacgctttgccccc
ctctatgaccaaattgcccaggaatattaccgcacctgcgagttaattctgaccattacc
gggcataagcgactcctggatggagatcccgatttacagcgatcggtacagctccgcaat
ggtaacattgtccccctcggctttctccaggttttattactcaaacgactgcggcaacac
cagagccaaaccagttctggggcgttattgcgatcgcgctacagtaagggcgaactgcgt
cgaggtgcgttgttaacgattaatggcattgccgccgggatgcgaaacacaggttaa

DBGET integrated database retrieval system