KEGG   Cyanothece sp. PCC 7425: Cyan7425_3420Help
Entry
Cyan7425_3420     CDS       T00836                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan7425_3420
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7425_3420
Enzymes [BR:cyn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cyan7425_3420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3372003..3372347)
Genome map
AA seq 114 aa AA seqDB search
MKTLPKERRYETFSYLPPLSDAQIARQIQYTLDQGYIPAVEFNEDSNAETYYWTMWKLPL
FNATSPQEVLNEVQQCRSEYSGSYIRVVAFDNVKQCQVMSFIVHKPNASGGYRY
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttacccaaagagcgtcgttacgaaaccttttcctacttgcctcctctcagc
gatgctcaaattgcccggcaaattcaatacaccctggatcagggctatattcctgccgta
gagttcaacgaagactctaatgctgaaacttactactggaccatgtggaagttacccctg
tttaacgccaccagcccccaggaagtgttgaatgaagtgcagcagtgccgttcggaatat
agtggcagctacattcgtgttgttgcttttgacaatgtcaagcaatgtcaggtgatgagc
ttcattgtgcataaacccaatgccagtggtggctatcgctactaa

DBGET integrated database retrieval system