KEGG   Cyanothece sp. PCC 8801: PCC8801_3469Help
Entry
PCC8801_3469      CDS       T00806                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCC8801_3469
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PCC8801_3469
   00680 Methane metabolism
    PCC8801_3469
Enzymes [BR:cyp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PCC8801_3469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3621257..3624331
Genome map
AA seq 1024 aa AA seqDB search
MSSLLESSSSIVEEINIFSTSDLFLRQRLKLVEELWEAVLRAECGQELVDLLKQLRTMCS
PEGQLTDITQTPITAVIEQLELNESIRAARAFALYFQLINIVEQHYEQRDQQLTRRANYC
DIDSKPANNHGESSTNPSIGHHLVERSWMDSENTSEKGGTFHWLFPHLKELNVPPQQIQR
LLDQLDIRLVFTAHPTEIVRHTIRRKQRRIVNILRRLDRAEEAFRGMGLSNSWEAQSAIE
QLTEEIRLWWRTDELHQFKPSVLDEVDYALHYFDEVLFEVLPQLSQRLQQSLKSSFPWLR
PPKNTFCRFGSWVGGDRDGNPFVTPEVTWKTACYQRNMVLKKYLESIRDLTEILSASLHW
SNVSQDLLDSLERDRVQMPEIYDELAIRYRHEPYRLKLAYIEKRLQNTRDRNNRLANPDQ
RQQLLYREEENIYHSGEEFWQELELIKRNLEETGLNCLELNNLLIQAEMFGFNLTQLDFR
QDSSRHADAIEEIAEYLNILPKPYTQLSEAEKTQWLIQELKTRRPLIPTGMQFKKPENSE
TVETLQMLRYLQQEFGLEICQTYIISMTNYVSDVLEVLLLAKEAGLYDPATSTTTIRIVP
LFETVDDLKRAPEVMEDLFKLPLYRASLAGGYDQLQPSETPSQGAVKSLNLPALQPTNLQ
EIMVGYSDSNKDSGFLSSNWEIHKAQKALQNMAQRYGVDLRLFHGRGGSVGRGGGPAYAA
ILAQPSSTINGRIKITEQGEVLASKYSLGDLALYNLETVSTAVIQASLLGSGFDDINPWN
EIMEDLAERARKAYRGLIYEQPDFLDFFLSVTPIPEISQLQISSRPARRKSGKADLSSLR
AIPWVFSWTQSRFLLPAWYGVGTALQSFVDEEPEENLKLLRYFYLKWPFFKMVVSKVEMT
LSKVDLQIAHHYVRELSKAEDKERFERVFEEISQEYHRTRDVILNITNHQRLLDSDLSLQ
RSVQLRNGTIVPLGFLQVALLKRLRQYSNQAQSGVIHFRYSKEELLRGAMLTINGIAAGM
RNTG
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgcttcttgaatcatcttcatccatcgttgaagaaattaacattttttcgact
tctgatctcttcttacgtcaacgtctcaaattagtggaagaactatgggaggcggtgtta
agggcggaatgtggtcaagaattggtggatttgctcaaacaactccggaccatgtgttcc
ccggaaggacagttaaccgatattacccaaacgccgattaccgcagtgattgagcaatta
gaattgaatgaatcaattcgggcagcaagggcgtttgcgctttattttcaattaattaat
attgttgaacaacattacgaacaacgggatcaacaactaacgcgacgggcaaattattgt
gatatcgacagtaaacccgccaataatcacggagaatcgtccactaatccttcaattggt
catcatttagtggaaagaagctggatggactcagaaaatacctcggaaaaagggggaaca
ttccactggctattccctcatctcaaagaactaaacgtccctcctcaacaaattcaacga
ctcctcgatcaactcgatattcgcctcgtttttacagcccatccgacggaaattgttcgc
cataccattcgacgcaaacaacggcgcattgtcaatattttacgacgcttagatcgcgct
gaagaagcctttcggggcatgggactgagcaattcttgggaagcacagtcggctattgaa
caactgaccgaagaaattcgcctctggtggcgtacagatgaactacatcagtttaaaccg
agtgttctcgatgaggtagattatgccttgcactacttcgatgaagtgttatttgaggtt
ttaccccaattatcccaacgattgcaacagtccctaaaatcttcctttccttggttacgt
cctcccaaaaataccttctgtcgttttggatcatgggttggaggtgatcgcgatggcaac
ccctttgttaccccagaagtaacgtggaaaaccgcctgttaccagcgtaatatggtgtta
aagaaatatttagagtcaattcgagacttaaccgagattttaagtgcgtccttgcactgg
agtaacgtttcccaagatttgctggactcattggaacgcgatcgcgttcaaatgccagag
atttatgatgagttagccatccgctatcgtcatgaaccctatcgcctcaaattggcttat
attgagaaacggctacaaaatacccgcgatcgcaacaatcgcttagccaaccccgatcaa
cgacaacagctattgtatcgggaagaagagaatatctatcattcaggggaagaattttgg
caagaactggagctaattaagcgaaatttagaagagacggggttaaattgcctagagctt
aataatttactgattcaagccgaaatgtttggctttaacctgactcaattggattttcgg
caagattcttcccgtcatgcggatgcgatcgaagaaattgcggaatacctgaatatttta
ccaaaaccctacactcagctttcggaagcggagaaaacccaatggttgatccaagaactg
aaaacgagaagaccccttattcccacgggaatgcagttcaaaaagcctgaaaatagcgaa
acggtagaaaccctacaaatgttgcggtatttgcaacaggaatttggcttagaaatctgt
caaacctacatcatcagcatgacaaattatgtcagtgatgtcctagaagtgttgttatta
gccaaagaagccggactttacgaccctgctacaagtaccaccaccattcgcattgttcct
ctatttgaaaccgtagacgacttaaaacgggctcccgaagtgatggaggatttatttaag
ttacccctgtaccgcgcatctctggcgggaggttacgatcaactgcaaccatcggaaacc
ccgagtcaaggggctgttaaatctcttaatctgccggctttgcaaccgacgaacctacag
gagattatggtgggatactccgatagtaacaaagattcgggttttttgagcagtaattgg
gaaattcataaggcgcagaaagccctccaaaacatggctcaacgttacggcgtagactta
aggctgtttcatggtcgtggcggctcggtgggacgcggaggagggcctgcctatgccgcg
attttagcgcagccctcgtctaccatcaatggacggattaagattactgaacagggggaa
gtcttagcctcgaagtattccttaggagatttggcgttatataacctagaaaccgtctct
actgcggtgattcaagcgagtttattagggagtggatttgatgatattaacccctggaat
gagatcatggaggacttagctgaacgtgcgcgtaaagcctatcggggacttatttatgag
caacctgattttctcgatttcttcctgtcggttacgcctattcccgaaattagtcaatta
cagattagttctcgtccggcacgacgcaaaagcggtaaagctgatttaagcagtttacgg
gcgattccttgggtatttagctggacacaaagccgttttctgcttccggcttggtatggg
gtaggaacagcgttacaaagctttgtcgatgaagaaccggaggaaaatttgaaattattg
cgttatttttacctaaaatggccattttttaaaatggtggtatctaaggtagaaatgacc
ctttctaaagtggatttacaaatcgctcatcattatgtgagggaattgtcaaaagcagaa
gataaagagcgatttgagcgagtttttgaggaaatatcccaagagtatcaccgtacccgt
gacgttattctcaatattactaatcatcaacgcttactcgatagtgatctgagtctccag
cgttcggttcagctacgcaatggaacaattgttccccttggctttttacaagtagctcta
ttgaagcggttacggcaatatagtaaccaagcgcagtcaggggtcattcatttccgctat
tctaaagaagagttgctgcggggggcaatgttaaccattaatggcattgctgcagggatg
cggaatacgggttga

DBGET integrated database retrieval system