KEGG   Cyanothece sp. ATCC 51142: cce_2750Help
Entry
cce_2750          CDS       T00686                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_2750 (pdhC)
   00020 Citrate cycle (TCA cycle)
    cce_2750 (pdhC)
   00620 Pyruvate metabolism
    cce_2750 (pdhC)
Enzymes [BR:cyt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     cce_2750 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(2806558..2807859)
Genome map
AA seq 433 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVSKGETVVVVESDKADMDVESFYDGYLATIL
VEAGQEAPVGDAIALIAETEEEIAQAKAKGSSGLSTPPPESPPKKEEKQPSQAPATTATA
TATAPSSTNGKSNRIVASPRAKKLAKQLGISLNSVEGSGPYGRIVAEDIEKAAGKTPTPP
SIPTQTTQPPKPTQTPTVAPATPTPAPVTAGETVPLNTLQKAVVQNMVATLQVPTFHVGY
TITTDELDKLYKKLKPKGVTMTALLAKAVAVTLEKHPLVNANYSEQGIRYPQSINIAIAV
AMPDGGLITPVLQNADKVDIYSLSRTWKDLVDRARAKQLQPEEYNSGTFTLSNLGMFGVD
RFDAILPPGQGSILAIGASSPQVVATPDGLLGVKRQMAVNITCDHRIIYGSHAAAFLQEF
ANLLETDVQSLTM
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatattttcatgcctgcattaagttctaccatgaccgagggaaaaattgtc
tcttgggtgaagtctccaggggataaagtttctaaaggtgaaaccgtggtcgtcgtagaa
tcagataaagcagatatggatgtagaatctttctatgatggctatctagcaactatttta
gtcgaagcagggcaagaagcccccgttggagatgcgatcgctttaatcgcagaaaccgaa
gaggaaattgcccaagccaaagcaaaaggctcctctggtttatctacacccccccctgag
tccccccctaaaaaagaagaaaaacaaccctctcaagcccctgcaaccaccgctacagca
accgctacagccccctcttcaactaacggcaaaagtaaccgcattgtggcttctcccaga
gccaaaaaattagccaaacaattagggatctctctcaacagtgttgaagggagtggcccc
tatggcagaattgtggcagaagatattgaaaaggccgcaggaaaaacccctacaccccct
tctattcccacgcaaaccacccaaccccctaaacccactcaaaccccaactgtggcccct
gcaaccccaacaccagcccctgttaccgcaggagaaaccgtacccctcaataccctacaa
aaagcagtggtgcaaaacatggtggctaccctacaggttcctactttccatgtgggttat
accattaccaccgatgagttagataagctctataagaaactgaagcccaaaggggtaacc
atgaccgcattattggctaaagcagtggctgttaccctggaaaaacatcctttagttaac
gccaattacagcgagcaaggcattcgttatcctcagtcgattaatattgcgatcgccgtt
gctatgcccgatggtggtttaattactcccgtcttacaaaatgccgacaaagttgacatc
tattctctatctcgtacctggaaagatttagtagacagagcaagagccaagcagttacaa
ccagaagaatataatagcggtacatttaccctatccaatttaggaatgtttggcgttgat
cgctttgatgccattttaccccccggacaaggttccattttagcgatcggtgcatcaagt
ccccaagtggtagccactcccgatgggttattaggggttaaacgtcaaatggctgttaat
attacctgcgatcatcgtattatttacggttcccatgcggctgctttcttgcaagagttt
gctaacttgttagaaacagatgtgcaatctttgactatgtaa

DBGET integrated database retrieval system