KEGG   Cyanothece sp. ATCC 51142: cce_3164Help
Entry
cce_3164          CDS       T00686                                 

Gene name
rbcS
Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    cce_3164 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    cce_3164 (rbcS)
Enzymes [BR:cyt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     cce_3164 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(3280671..3281006)
Genome map
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQIVRQVQYVLDQGMIPGVEFEENPLPETHFWTMWKLPL
FGASSAQEVLAEVRECRSEYPNAYIRVIGFDNIKQCQTMSFIVHKPNNRAF
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattacctaaagagcgtcgttacgaaaccctttcttatttaccccctttaacc
gatcaacaaattgttcgtcaagttcaatatgtattggatcaaggcatgattcctggggtt
gaatttgaagaaaaccccttacctgaaactcacttctggaccatgtggaagttaccttta
ttcggtgctagttctgctcaagaagtattagctgaagtacgggaatgtcgttctgagtat
cctaacgcttatattcgtgtgattggttttgacaacatcaaacagtgtcaaaccatgagt
ttcatcgttcataagcccaataaccgtgcattctaa

DBGET integrated database retrieval system