KEGG   Cyanothece sp. ATCC 51142: cce_3164Help
Entry
cce_3164          CDS       T00686                                 

Gene name
rbcS
Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
cyt00630  Glyoxylate and dicarboxylate metabolism
cyt00710  Carbon fixation in photosynthetic organisms
cyt01100  Metabolic pathways
cyt01120  Microbial metabolism in diverse environments
cyt01200  Carbon metabolism
Module
cyt_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cyt_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cyt_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    cce_3164 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    cce_3164 (rbcS)
Enzymes [BR:cyt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     cce_3164 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ACB52512
CyanoBase: cce_3164
CYORF: cce_3164
UniProt: B1WXH1
LinkDB All DBs
Position
complement(3280671..3281006)
Genome map
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQIVRQVQYVLDQGMIPGVEFEENPLPETHFWTMWKLPL
FGASSAQEVLAEVRECRSEYPNAYIRVIGFDNIKQCQTMSFIVHKPNNRAF
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattacctaaagagcgtcgttacgaaaccctttcttatttaccccctttaacc
gatcaacaaattgttcgtcaagttcaatatgtattggatcaaggcatgattcctggggtt
gaatttgaagaaaaccccttacctgaaactcacttctggaccatgtggaagttaccttta
ttcggtgctagttctgctcaagaagtattagctgaagtacgggaatgtcgttctgagtat
cctaacgcttatattcgtgtgattggttttgacaacatcaaacagtgtcaaaccatgagt
ttcatcgttcataagcccaataaccgtgcattctaa

DBGET integrated database retrieval system