KEGG   Cyanothece sp. ATCC 51142: cce_3822Help
Entry
cce_3822          CDS       T00686                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    cce_3822 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    cce_3822 (ppc)
   00680 Methane metabolism
    cce_3822 (ppc)
Enzymes [BR:cyt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     cce_3822 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
3958990..3962052
Genome map
AA seq 1020 aa AA seqDB search
MLLVMLLESLQSTVEEVNIFSTSDLFLRQRLKLVESLWESVLKAECGQELVDLLEKLRKI
CSPEGQVTDKPKTSINELIEGLELNEAIRAARAFALYFQLINIVEQHYEQRDQQLNRRAT
YQESEKARNNHAKEENKANGSVGADLLEKALVGGTENQEKGGTFHWLFPQLKRLNVPPQQ
IQRLLEQLDIRLVFTAHPTEIVRHTIRLKQRRIATLLRRLDYAEESFRGMGLSSSWEAES
IIEQLNEEIRLWWRTDELHQFKPSVLDEVDYTLHYFDEVLCDALPQLSQRLQQALKANFP
RIKPPHNTFCRFGSWVGGDRDGNPFVTPEVTWRTACYQRNLILEKYLAAIEDLTEILSSS
LHWSNVSQDLLDSLERDRVAMPEIYDELAIRYRQEPYRLKLAYIEKRLETTRDRNNHLAN
PEKRQILTEETPPNIYHSGEEFEAELQLIKRNLEETGLKCQALENLIFQAQMFGFTLTQL
DFRQESSRHSETIEVIANYLNVLPRPYGELSETEKVNWLVGELQTRRPLIPMEMPFDEKT
IETIETMRMLRYLQQEFGVEICQTYIISMTNDVSDVLEVLLLAKEAGLYDPGTSTTTIRI
VPLFETVDDLKRAPEIMDALFKLTLYRAALAGGYDYLDEAKKEQLPPPELQPANLQEIMV
GYSDSNKDSGFLSSNWEIHKAQKSLQKVAEPYGLALRLFHGRGGSVGRGGGPAYAAILAQ
PTGTINGRIKITEQGEVLASKYSLPELALYNLETATTAVIQASLLGSGFDDIVPWNDIME
ELASSARKAYRSLIYEQPDFLDFFLSVTPIPEISQLQISSRPARRKSGKKDLSTLRAIPW
VFSWTQSRFLLPAWYGVGTALESFLQQEPNENLKLLRYFYLKWPFFKMVISKVEMTLSKV
DLQIAHHYVKELSQPEDIERFNKVFERISQEYHRTRDIILSINEQPKLLEGDAGLQRSVQ
LRNGTIVPLGFLQVSLLKRLRQYTRQAESGVIHFRYSKEELLRGALLTINGIAAGMRNTG
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
ttgctactggttatgcttcttgaatcattacagtccacagttgaagaggttaacattttt
tcaacatcggatctcttcttacgtcagcgtctaaaattagtcgaaagtttatgggaatca
gtattaaaggctgaatgtggtcaagaattagtcgacctgttagagaagttacgaaaaatt
tgctcgccggaaggacaagttaccgataaaccgaaaacctctattaatgaactcatagaa
gggttagaactcaatgaagcgatccgcgcagcaagagcgtttgccctgtattttcaatta
attaatattgttgaacaacattacgaacaaagagatcaacaactaaaccgacgggcaacc
tatcaagagtcagaaaaagcccgaaacaaccacgccaaggaagaaaacaaggcaaatggt
tcggtaggagcagatttattggaaaaagccttagtgggaggcacagaaaaccaagaaaaa
ggcggaacctttcactggttattccctcaattgaaacggttaaacgttcccccgcaacaa
atccaacggttattagaacaactggatatccgccttgtttttaccgctcaccccacggaa
atcgttcgtcataccatccgactcaaacaaagacgcatcgccaccttactgagacgctta
gactacgcagaagagtcatttcggggcatggggttaagtagttcctgggaggcagaatcg
attattgaacaactcaacgaagagatccgtctctggtggcggactgatgaattacatcag
tttaaacccagtgttctcgacgaagtggactatactctacactatttcgacgaagtgtta
tgtgacgcactcccccaactgtctcaacgactgcaacaggctctaaaagccaattttccc
agaattaaaccccctcataacaccttctgtcgctttggatcttgggtaggaggcgatcgc
gatgggaaccccttcgttactccagaagtaacctggagaaccgcttgttatcaacgtaat
ctaattttagaaaaatatttggcagctattgaagatttaaccgagattttaagctcatcc
ttgcattggagtaatgtatctcaggatctcctggactccttagaacgcgatcgcgtggcc
atgcctgaaatttatgatgagttggccattcgttaccgtcaagaaccctatcgcctcaaa
ttagcttatattgaaaaacgtttagaaaccacccgcgatcgcaataaccatctggctaac
ccagagaaacgacaaattctaaccgaagaaacaccccccaatatttaccactctggggaa
gaatttgaagcagaattacaactcatcaagcggaatttagaagaaactgggttaaaatgc
caagcccttgaaaatctcatttttcaagcgcaaatgttcggctttaccctcacacaatta
gatttccgtcaagaatcttcccgtcactccgaaaccatcgaagtcattgccaattattta
aacgttttaccccgtccctacggcgaactatccgagacagaaaaggtcaattggttagtg
ggggaactacaaactcgtcgtcctctgattccgatggaaatgccattcgatgagaaaacc
atcgaaaccattgaaaccatgcggatgttgcgctatcttcaacaggagtttggtgtcgaa
atttgtcaaacctacatcatcagcatgaccaacgatgtcagcgatgtgttagaagtgttg
ttattagccaaagaagcaggactttacgatcctggaaccagtaccaccaccattcgcatt
gttcccctgtttgaaacggtagacgacttaaaacgggcccctgagatcatggatgcgttg
tttaagttaaccttatatcgggcggcgttagctgggggttatgactacttagacgaagcc
aaaaaagaacaattaccacccccagagttacaaccagccaacctacaagagatcatggta
ggttattccgatagtaataaagattctggtttcttgagcagtaactgggaaatacataag
gcccaaaaatccctacaaaaagttgcagaaccttacggtttagccttaagactgtttcat
ggtcgtgggggttccgtgggacggggtggcggtcctgcttatgctgctattttagcccaa
cccaccggtactattaacggacgcatcaaaatcaccgaacaaggggaagttttggcttct
aaatactccttaccagaactggccttatataacctagaaacggcaaccacggcggtgatc
caagccagtttactagggagtgggtttgatgatattgttccttggaacgacattatggaa
gagttggctagtagtgccaggaaagcttatcgtagtttgatttatgagcaaccagacttc
ttagacttcttcctatccgtcactcctatccccgaaattagtcaattacagattagttct
cgccctgccaggagaaaaagtggtaaaaaagatttaagtaccttacgggcaattccttgg
gtgtttagttggactcaaagtcgttttcttttgccggcttggtatggagtcggaaccgca
ttagaaagcttcttgcaacaagaaccgaatgaaaatttgaagttactgagatatttttac
ttgaaatggccattctttaaaatggtaatttctaaagtagaaatgaccctttctaaagtg
gatttacaaattgctcaccactatgttaaagaattgtctcaacccgaagatatagaacgc
tttaataaggtatttgagcgaatttctcaagagtatcatcgcacccgtgacatcatttta
agcatcaatgaacaaccaaaattattagaaggggatgccgggttacagcgttccgtacag
ttaagaaatggaaccattgttcctctcggtttcttacaagtttctcttcttaaacggtta
cgtcaatacacccgtcaagcggagtctggagtcattcatttccgttattccaaagaagaa
ttattaaggggtgcattgttaaccattaatggtattgctgctggaatgcggaatactggt
tga

DBGET integrated database retrieval system