KEGG   Desulfobacca acetoxidans: Desac_0135Help
Entry
Desac_0135        CDS       T01454                                 

Definition
(GenBank) DNA ligase D, 3'-phosphoesterase domain protein
Organism
dao  Desulfobacca acetoxidans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
162557..163180
Genome map
AA seq 207 aa AA seqDB search
MSQDDPLNTYRRKRDFAATAEPMGGTLDAGEAAPVFVIQKHAARRLHYDFRLEVDGVLKS
WAVPKGPSTNPQDKRLAAPTEDHPLEYATFEGVIPPGHYGAGTVLVWDLGTYRNLTEKKG
EAIPLPQALEHGHITVWLEGKKLRGAYSLTRFKKGRDESWLLVKKNDAEADASQDLLLTR
PESVLSGRTIEEVAAANELLSEELCSR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagacgatccccttaacacctaccgccggaaacgggattttgctgctacggcg
gagccgatgggaggaacactggatgcgggagaagcggcgcccgtctttgtcattcaaaaa
cacgccgcgcgtcggctgcattacgatttccgcttagaagtcgatggcgtcctcaaatcc
tgggcggtgcccaaaggtccctccaccaatccccaggacaaacggctggcggctcccacc
gaggaccatcccctggaatatgccacgtttgagggagttattcctccgggacactacggc
gccggtaccgtcctggtctgggatctgggaacctaccggaacctcaccgaaaaaaaaggc
gaggccattccactgccccaggcattggagcacggtcatattaccgtctggctggagggg
aaaaaactgcgcggcgcctactccttgacgcgcttcaagaaaggccgggatgaaagctgg
ctgctggtgaaaaagaacgacgccgaagccgatgcctctcaggatcttctcctgacccgg
ccagagtccgttctgagcggtcggactattgaggaagtagcggccgcgaatgaattactc
tccgaagaattatgttccaggtga

DBGET integrated database retrieval system