KEGG   Candidatus Desulforudis audaxviator: Daud_0207Help
Entry
Daud_0207         CDS       T00655                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
dau  Candidatus Desulforudis audaxviator
Brite
Translation factors [BR:dau03012]
 Eukaryotic Type
  Elongation factors
   Daud_0207
 Prokaryotic Type
   Daud_0207
Mitochondrial biogenesis [BR:dau03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Daud_0207
Exosome [BR:dau04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Daud_0207
  Exosomal proteins of breast cancer cells
   Daud_0207
  Exosomal proteins of colorectal cancer cells
   Daud_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
236872..238071
Genome map
AA seq 399 aa AA seqDB search
MAKPKFVRTKPHVNVGTIGHVDHGKTTLTAAITLVLSKLGQAEYKKYDDIDAAPEEKARG
ITINTAHVEYETEKRHYAHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVAVPSIVVYLNKADMVDDPELLELVEMEVRELLSNYEFPGDDTPIVTGSALKALE
CGCANRECAHCKSIWELMDAVDNYIPTPERDIDKPFLMPVEDVFSITGRGTVGTGRVERG
TVKTGDEVEIVGFAAKPRKTVVTGVEMFRKVLDYAQAGDNVGCLLRGVDRTELERGQVLA
KPGSIKPLTEFTANVYVLSKEEGGRHTPFFNGYRPQFYFRTTDVTGVIHLPEGVEMVMPG
DNLQMDVSLITPIAIEEGLRFAIREGGRTVGAGVVTAIK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacccaagtttgtgcgtaccaagccgcacgtaaacgtcggcacgatcggccac
gtggaccacggcaagaccacgctgacggcggcgatcaccctggtcctgtccaagttgggt
caggccgagtacaagaaatacgacgacatcgacgcggcgccggaggagaaggcgcgcggc
atcaccatcaacaccgcgcacgtggaatacgagaccgagaagcggcattacgcgcacgtg
gactgcccggggcacgccgactacatcaagaacatgattaccggcgcggcccagatggac
ggggcgattctggtggtctcggcggccgatggccccatgccccagacccgtgagcacatc
ctcctggctcgccaggtggccgtgccctccatcgtggtctacctgaacaaggccgacatg
gtcgacgatccggagttattggaactggtcgagatggaagtgcgcgagcttttgtccaac
tacgagtttccgggagacgacaccccgatcgtcaccggatccgccctaaaagccctggaa
tgcggctgcgccaaccgggagtgcgcgcattgcaagtccatctgggagttgatggacgcc
gttgacaactacattccgacgcctgagcgtgacatcgacaagcccttcctgatgccggtc
gaagacgtattttccatcaccgggcgcggcacggtgggcaccggccgggtggagcggggc
accgtgaagaccggggacgaggtcgagatcgttggtttcgcggccaagccgcgcaagact
gtggttacgggggtggagatgttccgcaaggttctggactatgcccaggccggagacaac
gtgggttgcctgttgcggggtgtggaccgtaccgagcttgagcggggccaggtattggca
aagccgggatccatcaagccgctgaccgaatttacggccaacgtgtacgtgctgagtaaa
gaagaaggtgggcgtcacaccccgttcttcaacggataccgtccgcagttctacttccgg
accaccgacgtgaccggcgtgattcatctgccggaaggcgtggagatggtgatgcctggg
gacaacctgcagatggacgtcagcctgatcaccccgatcgccatcgaagaaggcttgcgg
tttgccatccgcgagggcggccgcacggtgggcgccggcgtggtcacggcgatcaagtga

DBGET integrated database retrieval system