KEGG   Daucus carota (carrot): 108223221Help
Entry
108223221         CDS       T05350                                 

Definition
(RefSeq) DNA ligase 1-like isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr03030  DNA replication
dcr03410  Base excision repair
dcr03420  Nucleotide excision repair
dcr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dcr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    108223221
   03410 Base excision repair
    108223221
   03420 Nucleotide excision repair
    108223221
   03430 Mismatch repair
    108223221
Enzymes [BR:dcr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108223221
    6.5.1.6  DNA ligase (ATP or NAD+)
     108223221
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108223221
DNA replication proteins [BR:dcr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108223221
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108223221
DNA repair and recombination proteins [BR:dcr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108223221
   NER (nucleotide excision repair)
    Other NER factors
     108223221
   MMR (mismatch exicision repair)
    Other MMR factors
     108223221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 108223221
NCBI-ProteinID: XP_017252848
LinkDB All DBs
Position
5
AA seq 797 aa AA seqDB search
MITLHSGLFLLPRTPNLSTIARGLSPILRPNSSFFLKPPLFTSPNLKFPMSSSRPSAFDA
LMSKARAAAKKKPQSEASPAKKRKTQELVSVKEVENASLDDAHQVFDKKSKQENVVKCGD
NVGTEVLANGCKEGKVNLSLDEKLAVKKAEAVSLDESIAQLKNKPANFDPKKAAFWGEGK
KVPFSFVTRVFDAVDKESGRIVITEIVCNMLRTVIQTSPDDLLPVVYLLANRIAPAHEGL
ELGIGDASIIKALAEACGCNEAQIRKQYKDLGDLGLVAKASRSSQSLMRKPEALTVTKVF
NTFQLIAKESGKDSQEKKKNHIKALLVAATDFEPLYMIRLLQTKLRIGLAEQTLLAALGH
AAYYSEKRFKPPANIDSPSEEAAKIVKQVYSVLPVYDKIIPAILTGGVWDLPKACCFTPG
IPIGPMLAKPTKGVSEILDKFQDMEFTCEYKYDGERAQIHYLENGSVEIYSRNAERNTGK
FPDVVSALSRLKKSSVSSFVLDCELVAYDREKKKILPFQVLSTRARKNVMISDIKVEVCI
FAFDILYLNGQTLLQEQLNVRKEHLYKSFEEEPCYFQFATAMTSTDLEEIQKFLEDSVDA
SCEGLIIKTLSRDATYEPSKRSNNWLKLKKDYMESIGDSLDLVPIAAFHGRGKRTGVYGA
FLLACYDSSSEAYQTICKIGTGFTEQVLEERSTSLRSKVIPKAKSYYRYADKISPDVWFE
TTEVWEVKAADLTISPVYCAAIGIVDSEKGISLRFPRLVRVREDKAPEQASSSEQVAEMY
KAQKHTQKHYEDDDKDE
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgattacactccattcaggactctttctccttcctcgcacacccaatctctccactatt
gcgcgtggtctctctccgattctcagacccaattcgtcattttttctcaaaccccctctt
tttacaagccctaatttgaaattccccatgtcttcttcacgcccttcggctttcgatgct
ttaatgtcaaaagctcgagccgctgcgaagaaaaaaccccagtccgaggcttctccagcc
aagaaacgcaagacccaggagttagtttctgtaaaagaggttgagaacgcgagtttggat
gacgcgcatcaggtgtttgataaaaagagtaaacaagaaaatgttgtgaaatgtggtgat
aatgtgggtactgaggttttggcaaatgggtgcaaggaaggtaaggtaaatttgagtctg
gatgagaaattggcggttaagaaggccgaggctgttagtttggatgagagtattgcacag
ttgaagaataagccggcgaattttgatccaaagaaagctgcattttggggggagggtaag
aaagttccgttttcgtttgtgactagagtgtttgatgctgttgacaaggagtcagggaga
attgtgattactgagattgtgtgtaatatgttgaggactgtgatacagacgtcaccggat
gatttgcttccggttgtttatcttttagcgaatcggatcgcacctgctcatgaagggttg
gagcttggaattggggatgcgagtattattaaagcgctggctgaagcttgtggatgcaat
gaagctcagattaggaagcagtacaaagatttgggagatttgggattggttgcaaaagcc
agccgctcatcacagtctttgatgcgcaaacctgaggcattaacagtcactaaggtcttt
aacacatttcagctcattgccaaggaatctggcaaggatagtcaagagaagaaaaagaac
catatcaaggcactccttgttgctgctactgattttgagcctctgtatatgatccgctta
ctgcagacaaaattacgaattggtttggcagagcaaactctattggctgctctgggtcat
gctgcttattacagtgaaaagcgtttcaaacctcctgcaaatatagattctccttcagaa
gaggctgcaaagatagttaaacaagtttactctgtgcttcccgtctatgacaaaataatc
cctgccatccttactggtggtgtatgggatctcccgaaggcatgctgttttacacccggg
attcctattgggcctatgctagcaaaaccaacgaaaggagtgtctgagattttggataag
tttcaagatatggaattcacatgcgaatacaagtatgatggagaacgtgctcagatacat
tacttggagaatggttcagttgagatttacagtcgaaatgctgaaagaaatacgggaaag
tttccagatgttgtttctgctctttcaagactaaagaagtcatctgtttcatcatttgtt
ttggattgcgagcttgtcgcttatgaccgtgagaaaaagaaaatcttacctttccaggtt
ttaagcacacgtgcccgcaaaaatgtaatgatcagtgacatcaaagttgaagtttgcatt
tttgcatttgatattctttacctgaatggtcagacacttctacaggagcagcttaatgtt
cgtaaggaacatctgtataagtcatttgaggaagaaccctgctattttcagtttgctaca
gcaatgacatccactgatcttgaggaaatacagaagtttcttgaggattctgtcgatgca
agctgcgagggactgattatcaaaacattaagtagagatgctacatatgaaccttcaaag
aggtcaaataactggctcaaactaaagaaagattacatggaaagtattggcgattcactt
gatctagtacctattgctgctttccatggacgagggaaacgaactggtgtatatggcgct
tttctgcttgcttgttatgatagcagcagcgaagcatatcaaaccatttgtaaaatcggc
actggatttactgaacaagtgcttgaggagagatctaccagtctacgttctaaagtgatc
ccaaaggcaaagtcctactatcgttatgcagataagatttctccagatgtatggtttgaa
acaaccgaggtttgggaggtcaaagctgcagatttgaccatcagtcccgtctattgtgct
gccatcgggattgtggattctgagaagggcatctctctccgatttccacggctggttcgt
gtacgagaagacaaggctccagagcaagcttcatcatcggaacaggtagctgaaatgtat
aaagctcaaaagcacacccaaaagcactacgaagatgatgataaggacgagtga

DBGET integrated database retrieval system