KEGG   Desulfitobacterium dehalogenans: Desde_1277Help
Entry
Desde_1277        CDS       T02146                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ddh  Desulfitobacterium dehalogenans
Pathway
ddh00473  D-Alanine metabolism
ddh01100  Metabolic pathways
ddh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ddh00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Desde_1277
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Desde_1277
Enzymes [BR:ddh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Desde_1277
Peptidoglycan biosynthesis and degradation proteins [BR:ddh01011]
 Precursor biosynthesis
  Racemase
   Desde_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFL99706
UniProt: I4A6X2
LinkDB All DBs
Position
1287384..1288496
Genome map
AA seq 370 aa AA seqDB search
MENIRPVWTEINLQALQRNYDRIQALTQSEIMPIVKADAYGHGASQVVEVFYKKGARRFG
VALLDEALELKKAYPDIKVMLIGSLPMESLATIIKEDIICGVYRLEQAVLLSEEAKRQGK
KAVIHLKVDTGMGRIGFREEDWEELFDCTKLPSLYIEGIYTHFATADHGDLRFAREQLKE
FLAICDRIKAQGVHIPIRHAANSGALLQMPEAHLEMVRPGIILYGLPPSRHVGNDIGLEP
VLSWKARISHIKMVPQGETISYGRTFRTAYPTRVATIPIGYADGLRRSLSNKGEVLIKGR
RTTMIGRICMDQTMLDVTKVPDVQMGDEVTLLGTDGYERIDATEMAGWLNTINYEIVCGI
SKRVPRIYIK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatacggccggtttggacagaaatcaatttacaagctctgcagaggaattat
gaccggattcaggcattgacccaaagtgaaatcatgccgatagtcaaagccgatgcatac
ggacatggagcctcacaggtagtagaagtattttataaaaaaggtgctcgtcgttttggg
gttgctttattggatgaagccttagagcttaagaaggcgtatccggatataaaggtgatg
ctcatcggttctttgcccatggaatccttagcaacaatcattaaagaagatattatctgc
ggggtgtatcggttagagcaagcggtactcttgtcggaagaagctaagagacaaggcaag
aaggcggtaattcatcttaaggtggatacaggaatggggcgtattggctttagagaagag
gattgggaggaacttttcgactgtaccaagctgcctagtctttacatagagggaatctat
acccactttgccacggctgatcatggagatttaaggtttgcccgagagcaattgaaggag
tttttggcgatttgtgacagaatcaaagcacaaggagtccatatacccatccgacatgcg
gccaacagtggagctctgctgcagatgccggaggcccacttggagatggtgcggccgggg
attatcctttatggacttcctccctcccggcatgtgggtaatgatattggcctggagcct
gtactttcatggaaagccagaattagtcatataaagatggttccccaaggggaaaccata
agctatggcaggaccttcagaacggcctatcccacccgagtggcgacgattcccattggc
tatgctgatggtctgcgccgaagtctgtccaataagggtgaagttttaattaaaggcaga
agaacgaccatgatcgggagaatctgtatggatcagactatgctggatgtcacgaaagta
ccggatgtacaaatgggcgatgaggttactttacttggtacggatgggtatgaacggatc
gatgccaccgaaatggccggttggttaaataccataaattatgaaattgtgtgtggaata
tcgaagcgagttccacggatatatattaagtaa

DBGET integrated database retrieval system