KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289257Help
Entry
DDB_G0289257      CDS       T00245                                 

Gene name
set1
Definition
(RefSeq) SET domain-containing protein
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    DDB_G0289257 (set1)
Enzymes [BR:ddi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     DDB_G0289257 (set1)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     DDB_G0289257 (set1)
   HMT complexes
    COMPASS/SET1 complex
     DDB_G0289257 (set1)
    COMPASS/SET1 complex (yeast)
     DDB_G0289257 (set1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET SET_assoc
Motif
Other DBs
NCBI-GeneID: 8627040
NCBI-ProteinID: XP_636258
dictyBase: DDB_G0289257
UniProt: Q54HS3
LinkDB All DBs
Position
5
AA seq 1486 aa AA seqDB search
MENETIVDNSLNNKSNVNNSNNDINNSKSNNNNTNTNYNNNHNNTTTTTTINKTEEKQND
SPKDSEFEFLDELKGVDDQHHVFSSEDESYTNGNKKRKQTDTPLSPNQDLKKRSITSPTT
SPTTSTSTSTSTSTSTSTSTIINNNNNNLKDKTKEEIEFIKHIRSQLVKPKFLKDKPNFP
LRSSGGNWIFVGKLPSLQSTTTDNTTLMSPNNATTTNGSSSNISTTTTTTTTTTPTTKIL
YRVNGFLSDNETIDSIEINFGDPRDRYEIERLHSSRINNPFELPCVSFKNPLFIKSNIAK
DIGISNEYGGMNDSFEFSNQPPPPSPPPPPPPTLPPPPPPTLPPQHSLEQQSTKQQIFTQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQIPKINQQHYSTQPSVLIDDIYDPSNPTE
PISPHQDHYPNFIFSKLQRYEHLPTRNPISQYDYRDRPRDWERDRDRDWERDRDWERDRD
RERDRDRDRDWERDRDWERDRDWERDRDRDRDWERDRDRDWERDRDRDWERDRERDRDRY
DRQTNFSPAPQSTTTSASTSSTTSSTDKNSNNTTSTSVSATTSTTKRKSKFSEPIEPSPF
AIQIPRDNIKINGNLINNSSSSSSSGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNN
NNSDVKDIKDKLLKQFKIYDPVNVYMDESYWYIDFRSSESRERAIQVLNGSFIDTWKLNV
DNKKTNTINEELQKQKQLENDSNNNKPNNFNLLENERSLKEICKLLVATELLSTSSKDIS
KNFIEAEILKTIKLLDSQRIDPLTQNSTIINNTTNTTTSNINNTSNNTTVTPIVTPKSII
SAPTSRDSPRGGRSSSTTTKKPSKLDLNGSGVPPTLKKLDTIKQQQQPQPPLSPLKRPPK
SHFYSDSEDDGNNNNDDDDDDDDDEDDDFDQELSPLHSSRDSKKNIKSIIKKKPIYSDDD
DDHYHHHNHHHNHHHHHHHDRSEVELYNESDLQVDVLDSDNENQDESDYHKSSDNFGHVE
LSDDDNEFDSLDTDQDLYDTEENDNGKKSNKRPRKSKFNGKSKKPTTTTSTTTTATKSKG
RSKKTTITTPTHNIPVLDEIQSNLDDEDASYVSMVMAADKDIKLLFSTKSEEGFEDSSQE
ILSTPTRTKPSRNRKERNLPFLDEEDDESFKQLPQPQQKQEKQEKHEHKLKNKELKQKNN
EVIINKTEEHFSENLNGDNNNNNDKSENENENENENKNENENDNNNLNTSIDNINGVERR
SITGCARSEGYTRSDIQKLFKRKQVAPTGKRGAASSASSGSNSSSSSTAESFETGGNLSK
SARSSRFDNRGFGSDPITLASLKSRRKRIKFERSDIHDWGLFAMETISAKDMVIEYIGEV
IRQKVADEREKRYVKKGIGSSYLFRVDDDTIIDATFKGNLARFINHCCDPNCIAKVLTIG
NQKKIIIYAKRDINIGEEITYDYKFPIEDVKIPCLCKSPKCRQTLN
NT seq 4461 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgaaacaatcgtggacaacagtttaaataataaaagcaatgttaataatagc
aataatgatataaataatagtaaaagcaataataacaacaccaacaccaattataacaat
aatcataataataccaccaccacaacaacaataaacaaaacagaagaaaaacaaaacgat
agtccaaaagatagcgaatttgaatttttggacgaattaaaaggtgttgatgaccaacat
catgtattttcatcagaggatgaaagttatacaaatggcaataaaaaaagaaaacaaaca
gatactccattatcacccaatcaagatttaaagaaaagatctataacttcaccaacaacc
tcaccaacaacttcaacatcaacctcaacctcaacctcaacttcaacatcaacttcaaca
attataaataataataataataatttaaaagataaaactaaagaagagattgaatttata
aaacatattagatcacaattggttaaaccaaagtttttaaaggataaaccaaactttcca
ttgagatcaagtggagggaattggatatttgttggaaaattaccaagtttacaatcgaca
actactgacaacactacattaatgtcaccaaataatgccaccacaactaatggtagtagt
agcaatatttcaacaacaacaacaactacaacaacaacaacaccaactacaaagatctta
tatagagtgaacggatttttaagcgataatgaaaccattgactcgatcgaaatcaacttt
ggtgatccaagagatagatatgaaattgaaagattacattcttctagaattaataatcct
tttgaattaccttgtgtttcttttaaaaatcctttatttattaaatcaaatatagctaaa
gatattggaatttcaaacgaatatggaggaatgaatgattcatttgaatttagtaatcaa
cctccaccaccttcaccaccacccccaccacctccaactttaccacccccaccacctcca
actttaccaccacaacactcactagaacaacaaagtacgaaacaacaaatatttactcaa
caacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaa
caacaacaacaacaacaacaacaacaacaacaacaaataccaaaaataaaccaacaacat
tacagcactcaaccatctgttttgattgatgatatatatgatccaagtaatccaacagag
ccaatttctcctcatcaagaccattatccaaattttatattttccaagttacaacgttat
gaacatttacctactagaaatcctatttcacaatatgattatagagataggcctagagat
tgggaaagagatagggatagagattgggaaagagatagagattgggaaagagatagagat
agagaaagagacagagatagagacagagattgggaaagagatagagattgggaaagagat
agagattgggaaagagacagagatagagacagagattgggaaagagacagagatagagat
tgggaaagagatagagacagggattgggaaagagatagggaaagagatagggatagatat
gatcgtcaaacaaacttttcaccagcaccacaatcaactactacttctgcttctacctcc
agcaccacttctagtactgataaaaatagtaataatacaacatctacttcagtttctgca
acaacatcaacaactaaaaggaaatctaaatttagtgaaccaattgaaccatcaccattt
gcaattcaaattccaagggataatataaaaataaatggtaatctcataaacaatagtagt
agtagtagtagtagtggcaataataataataataataataataataataataataataat
aataataataataataataataataataataataataataataacagcaacaacaataat
aataatagcgatgtaaaagatataaaagataaattattaaaacagtttaaaatctatgac
ccagttaatgtatatatggatgaaagttattggtatattgattttagatcatcagaatca
agagagcgtgcaatacaagtattgaatggatcatttatagatacttggaaattaaatgta
gataataaaaaaaccaatacaatcaatgaggaattacaaaaacaaaaacaacttgaaaac
gacagtaacaataacaaaccaaacaactttaatctacttgaaaatgaaagatcattaaaa
gagatttgtaaattattagtagcaacagaattactttctacctcttcaaaagatatttca
aaaaattttattgaggctgaaatacttaaaacaattaaattattggattctcaaagaatt
gatcctttaactcaaaatagtacaattataaataatactacaaataccactacttcaaat
attaataatactagtaataatacaacagtaacaccaatagtaacaccaaaatcaataata
tcagcaccaacatctagagatagtcctagaggaggaagatcatcatcaacaacaacaaag
aaaccatcgaaattagatttgaatggtagtggcgtaccaccaaccttaaagaaattagac
acaattaaacaacagcaacaaccacaaccaccattatcgccattaaagagaccacctaaa
agtcatttctatagtgatagtgaagatgatggaaataataataatgatgacgatgacgat
gatgacgatgacgaggacgatgatttcgatcaagaattatcaccacttcactcttcaaga
gatagtaaaaagaatataaaatcaatcattaaaaagaaaccaatctattctgatgatgac
gatgatcattatcatcatcataatcatcatcataaccatcatcatcatcatcatcatgat
cgtagtgaagttgaactttataatgaaagtgatttacaagtagatgttttagatagtgat
aatgaaaatcaagatgaaagtgattatcataaatcatcagataactttggtcatgtagag
ttatctgatgatgataatgaatttgattctttagatactgatcaagatttatatgatact
gaagaaaatgataatggaaagaaatcaaataaaagacctagaaaatcaaaattcaatggt
aaatcaaagaaacctaccaccaccacttcaacaacaacaacggcaactaaatcaaaaggt
agatcaaaaaaaactactattaccacaccaactcataatataccagttctcgatgaaatt
caaagtaatttagatgatgaagatgcttcatatgttagtatggttatggctgctgataaa
gatattaaacttttattttctacaaaatctgaggaaggttttgaagattcttcacaagaa
atattatcaacaccaactagaactaaaccatcaagaaatagaaaagaaagaaacttacct
ttcttggatgaagaagatgatgaatcatttaaacaattaccacaaccacaacaaaaacaa
gaaaaacaagaaaaacatgaacataaacttaaaaataaagaattaaaacaaaaaaataat
gaagttattataaataaaacagaagaacattttagtgaaaatcttaatggtgataataat
aataataatgataaaagtgaaaatgaaaatgaaaatgaaaatgaaaataaaaatgaaaat
gaaaatgataataataatttaaatacaagtattgataatataaatggagttgaaagacgt
agtattacaggatgtgcacgttcagaaggttatactagaagcgatattcaaaaactattt
aagagaaaacaagttgcaccaactggtaaaagaggtgctgcatcaagtgctagtagtggt
agtaattcatcatcctcctcaacagcagaatcatttgaaactggtggtaatttatctaaa
tcagcaagatcatcaagatttgataatagaggatttggtagtgatccaattacattggca
tcattaaaatcaagaagaaagagaattaaatttgaacgttcagatattcatgattggggt
ttatttgcaatggaaactattagtgcaaaggatatggtaatcgaatatattggtgaagtg
attcgtcaaaaggttgcagatgaaagagagaaacgttatgttaaaaaaggtattggtagt
agttatctatttagagtcgatgatgatacaatcatcgatgctacattcaagggtaatcta
gcaagattcatcaatcattgttgtgacccaaattgtattgcaaaagtgctcactattgga
aatcaaaagaaaattatcatttacgcaaaacgtgacattaacattggtgaagaaattact
tacgattataaattcccaattgaggatgttaaaattccttgtttatgtaaatctccaaaa
tgtagacaaactttaaattaa

DBGET integrated database retrieval system