KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292760Help
Entry
DDB_G0292760      CDS       T00245                                 

Gene name
lig4
Definition
(RefSeq) BRCT domain-containing protein
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ddi00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    DDB_G0292760 (lig4)
Enzymes [BR:ddi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DDB_G0292760 (lig4)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     DDB_G0292760 (lig4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
dictyBase: 
UniProt: 
LinkDB All DBs
Position
6
AA seq 1088 aa AA seqDB search
MALSLYYDEDDDENENENKDKPNNDFKNQQQINTSKTTNNNNNINNKNNYNNKFNDDDIF
NNDKIITKPRVTTTTTTTKNTSTNSNINKTKFNDDDIFDDEDEDSNSNKTTTTTTTTTTT
TDTIITNDYRYQKTVPFSSFCDLMNRIINDTKISNKKNYLEKFMNHYKDEPNNFYQLLRL
ILPQLDKDRNSYGLKEKTLARLYVELLNISPESVDAMRLLNWKKSTNDEIGGDFGTAVYL
SLKNRCNNDNGRIKVSMGDINESLDQLSQPLTDKKTKVSILKKVLRSTTAQEQKWFVRII
LKEMKNGLSDNITLKFFHPDAIDHFNITSNLRLVCTNLFYMTQSKQKELKDKQKLEEKEN
LLKQQQQQQNDLDIYKLEIKLFNPIKPMLANRQSIDNLSMILNSAISATQFVVEKKFDGE
RIQIHKDGEQVKYFSRNSNDSTGIYGSMFTPIVKECVLAERCILDGELIVWDSISQRFED
FGNLKTLALNKDGISGSGDPLGINYGKQLCFIAFDILFVKDQSVMNLPLMQRLMLLKRCV
TIKSKQFEISEQTTVNSISQIISLLESAIINREEGLMLKNLHSLYVPAERKDKWVKIKPE
YIDGMGNGADDLDLVIIGGYYGSGLNRRGGTISHFMLGVPFIADSTDTDIDDESTFDKNV
IFYSFCKVGSGYTDIQLKSLQKDLDPHWNNFSTSKPPSIIQLAEPFKEKPDVWIDPRVYS
KVLQIKASQIVVTDKYKCGYTLRFPRVLKIRDDKGWKDCCSHEEIIDLFTNYSTNLNFKR
DHEYGDGSGGKNKKLKKSKKTTNQLLADSGLKVLSIFQDTDTSGIIPTQNIFQGIEICVI
KGSSGEYTKSKLEIMIVEMGGSKVQYPSRNTNYVISSKEVVKIQNLIQSGFIDIVSFNWI
VDCYNEKRLVPLGPKYMIFSTESTKKRFLLDSDQFGDSYINETTEQSLKDSFNQIDKLKL
KKQLSINSTTTTTTTSISKYFSNCWWSLFKEFTFYLDLYQVVGEKSTLIENNNLELSNLN
IQFYGGKISIEFNNKITHVVLDSLDLSRITFIKNKINSLSLPIQIVTTNWIQLSINNYSI
QPILEILD
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atggctttatctctttattatgatgaagatgatgacgaaaatgaaaatgaaaacaaagat
aaaccaaataatgattttaaaaatcaacaacaaataaatacatcaaaaaccactaataat
aataataatattaataataaaaataattataataataaattcaatgatgatgatatattt
aataatgataaaattataaccaaaccaagagtaacaacaacaacaacaactaccaaaaat
acatcaaccaattcaaatataaataaaaccaaatttaatgatgatgatatatttgatgat
gaagatgaagatagtaatagtaataaaacaacaacaacaacaacaacaacaacaacaaca
acagatacaataataacaaatgattatagatatcaaaaaacagtaccattttcatcattt
tgtgatttaatgaatagaattattaatgatacaaagattagtaataaaaagaattattta
gagaaatttatgaatcattataaagatgaaccaaataatttttatcaattacttagatta
atattaccacaattggataaagatagaaatagttatggattaaaagagaaaacattggca
agattatatgttgaactattgaatatatcaccggaaagtgttgacgcaatgaggttatta
aattggaagaaatcaaccaatgatgaaattggtggtgatttcggtactgctgtttattta
tcgttaaagaatagatgtaataatgataatggtagaattaaagtctcaatgggtgatatc
aatgaatcgctagatcaactaagtcaaccattaacagataagaaaacaaaagtttcaatc
ttaaaaaaagtattacgatcaaccacagcacaagaacaaaagtggtttgtacgtatcatt
ctaaaagagatgaaaaatggactctctgataacatcactttaaaattctttcatcctgat
gcaatcgaccattttaatataacttcaaatttaagattagtatgtacaaatttattttat
atgacacaatcaaaacaaaaagaattaaaagataaacaaaaacttgaagaaaaagaaaac
cttttaaaacaacaacaacaacaacaaaatgatttagatatttataaattagaaattaaa
ttatttaatccaataaagccaatgttggcaaatagacaaagtattgataatttatcaatg
atattgaatagtgcaatttcggcaacacaatttgtggttgaaaagaaatttgatggtgaa
agaattcaaattcataaagatggtgaacaggttaaatacttttcaaggaatagtaatgat
tcaaccggtatatatggctcaatgtttacaccaattgttaaggagtgtgttttggccgag
agatgtatattggatggtgagttgattgtatgggattccatatcacaacgatttgaagat
tttggtaatttaaaaacattggcattgaataaggatggtatttcaggtagtggtgatccg
ttgggtataaattatggcaaacaactttgtttcattgcatttgatattctatttgtaaaa
gatcaaagtgtgatgaacttaccattaatgcaaagattaatgctattaaaacgttgtgta
acaataaaatcaaaacaatttgaaatctctgaacagacaactgtgaattcaatttcccaa
atcattagtttactagagagtgcgatcatcaatcgtgaagaaggtttaatgttaaagaat
ttacattccctctatgtacctgctgaaagaaaagataaatgggtgaaaattaaaccagag
tatatagatggcatgggtaatggtgccgatgatttggatttggttattattggtggctac
tatggcagtggtttgaatagaaggggtggcacaatctcccatttcatgttgggtgtacct
tttatagcagattccaccgacactgacattgatgatgaatcaacatttgataagaatgtt
atattctattcattttgtaaagttggttcaggctataccgatatacaattgaaatcccta
caaaaggatttagacccacattggaataacttcagtacaagtaaaccaccatcaataatt
caattggctgaaccattcaaagagaaacctgacgtttggattgatccaagagtttattca
aaagtacttcaaattaaggcatcccaaatcgttgtaactgataaatacaaatgtggctac
actcttagattcccaagagtattaaaaattagagatgataaaggttggaaagattgttgt
agtcatgaagaaatcattgacctctttacaaactattcaacaaatttaaattttaaaaga
gatcatgaatatggtgatggcagtggtgggaaaaataaaaaattaaagaaatcaaagaaa
actacaaaccaactattagccgatagtgggttaaaagtattatcaatatttcaagatact
gacacaagtggtattataccaactcaaaatatatttcaaggtattgaaatttgtgttatt
aaaggtagtagtggggaatacacaaaatcaaaattagaaattatgattgttgaaatgggt
ggttcaaaagttcaatatccatcaagaaacacaaattatgtaatctcttcaaaagaggtt
gtaaaaattcaaaatttaattcaatctggtttcattgatatcgtatcttttaattggatt
gtagattgttataatgaaaaaaggttagtcccattaggtcctaaatatatgattttctca
actgaatcaacaaagaaaagatttcttttagattctgaccaatttggtgattcctatata
aacgaaactactgaacaatctttaaaagattcttttaatcaaattgataaattaaaatta
aaaaaacaattatcaatcaattctactactactactaccactacttctatttcaaaatat
ttttcaaattgttggtggtcattatttaaagaatttacattttatttagatttatatcaa
gttgttggtgagaagtcaacattaattgaaaataataatttagaattatcaaatttaaat
attcaattttatggtggtaaaatttcaatagaatttaataataaaatcactcatgttgtt
ttagattctttagatttatcaagaattacttttattaaaaataaaatcaattcattatca
ttaccaattcaaattgttactacaaattggattcaactttcaattaataattattcaatt
caaccaattttagaaattttagattaa

DBGET integrated database retrieval system