KEGG   Desulfovibrio desulfuricans ATCC 27774: Ddes_0045Help
Entry
Ddes_0045         CDS       T00837                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dds  Desulfovibrio desulfuricans ATCC 27774
Pathway
dds00250  Alanine, aspartate and glutamate metabolism
dds00410  beta-Alanine metabolism
dds00430  Taurine and hypotaurine metabolism
dds00650  Butanoate metabolism
dds01100  Metabolic pathways
dds01110  Biosynthesis of secondary metabolites
dds01120  Microbial metabolism in diverse environments
dds02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dds00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Ddes_0045
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ddes_0045
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ddes_0045
   00430 Taurine and hypotaurine metabolism
    Ddes_0045
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Ddes_0045
Enzymes [BR:dds01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Ddes_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACL47965
JGI: Ddes0045
UniProt: B8J1X0
LinkDB All DBs
Position
complement(59454..60860)
Genome map
AA seq 468 aa AA seqDB search
MTAKNTLRNTVLDDTYAASDMANAMPRHEMPQQESRPRDVYQAIHDELMLDGNSRQNLAT
FCQTWVDPEINQIMAECVDKNMIDKDEYPQTAETETRCVHMLADLWHSPDPKGTLGCSTT
GSSEAAMLGGLAMKRRWVNMRKAAGKPYDKPNMVCGPVQVCWEKFARYWDVELREIPMEK
DRLIMTAEEVIKRCDENTIGVVPTLGVTFTGQYEPVEEVSKALDKLQKDKGWDIPIHVDG
ASGGFLAPFIEPDLLWDFRLPRVKSINSSGHKFGLAPLGVGWVVWREKSDLPEDLIFNVN
YLGGNMPTFALNFSRPGGQIIAQYYNFLRLGREGYRRIHQNCYDTARFLGDEIAKLGPFE
VLYNGRGGIPALCWTFKANAKTSYSLYDLSDRLRSRGWQVPAYSMPAHREDLVVMRVLVR
HGFSRDLGSLLVDDLKRAMAHFDAHPVSKPLSETEAGSNSHAGRAAKK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgaaaaacaccttgcgcaatacggtacttgatgacacctatgccgcgtcggat
atggcaaatgccatgccgcgccatgagatgccccaacaggaaagccgcccccgcgacgta
taccaggccattcatgatgagcttatgctggacggcaattctcgccagaacctggcgacg
ttctgccagacctgggtagaccccgagatcaaccagatcatggccgagtgcgttgacaaa
aacatgatcgacaaggacgaatacccgcagactgccgaaacagaaacacgctgcgtgcac
atgctggccgacctgtggcattcgccggaccccaagggaaccctaggctgctccaccacc
ggttccagcgaagccgccatgcttggcgggcttgccatgaagcgccgctgggtcaacatg
cgcaaggccgccggaaagccctatgacaaacccaacatggtgtgcggccccgtgcaggtc
tgctgggaaaaattcgcccgctactgggacgtggaactgcgcgaaattcctatggaaaaa
gaccgcctgatcatgaccgccgaagaggtcatcaagcgttgcgatgaaaataccatcggc
gttgtgcccacccttggcgtgacctttaccggccagtatgagccggtggaagaagtaagc
aaagccctcgacaaactgcagaaggacaagggctgggacattcccattcatgtggacggc
gccagcggcggctttcttgccccgttcatcgagccggacctgctctgggatttccgcctg
ccccgcgtcaagtccatcaactcttccggtcacaaattcggccttgccccgcttggcgtg
ggctgggtagtgtggcgcgaaaaaagcgacctgcccgaagacctgattttcaatgtgaac
tacctgggcggcaacatgcccacctttgcgctcaacttctcccgccccggcggccagatc
atcgcccagtactacaacttcctgcgtctgggacgcgaaggctaccgccgcattcaccag
aactgctacgatacggcccgcttcctgggcgacgaaatcgccaagctcggtccctttgaa
gtgctgtacaacgggcgcggcggcatcccggccctgtgctggaccttcaaggccaatgcc
aagaccagctacagcctctatgacctctcggaccgtctgcgctcgcgcggctggcaggtg
cctgcctactccatgcccgctcaccgcgaagacctcgtggtcatgcgcgtactggtacgc
cacggcttcagccgtgacctcggctccctgcttgtcgatgacctcaagcgggccatggcc
cactttgatgcacaccccgtcagcaaacccctgagcgaaaccgaagccggcagcaacagc
cacgccggacgcgctgcaaaaaaataa

DBGET integrated database retrieval system