KEGG   Dyadobacter fermentans: Dfer_0365Help
Entry
Dfer_0365         CDS       T00970                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Dfer_0365
Enzymes [BR:dfe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dfer_0365
DNA repair and recombination proteins [BR:dfe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Dfer_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ACT91634
UniProt: C6VYF5
LinkDB All DBs
Position
complement(417793..420501)
Genome map
AA seq 902 aa AA seqDB search
MTLSKYNEKRKFDKTPEPKGGKGDNDELIFVIQKHDATRLHYDFRLEMEGVLKSWAVPKG
PSTDPSVKRLAMMVEDHPYDYKDFEGIIPKGNYGAGTVMVWDFGTYEPLEEVNGKLKAVK
GKKAREKLALKELHSGSLKVRLNGKKVKGEYALVKTKGMEENAWLLIKHRDKYASEDDIT
EKDRSAVSRRTLAGIEKAGDAIWESNHEEKKSTKGKTKAAKTEAKDPAEEAATEKKSPDE
DIAAILKKGKKQKFPDDLQPMLATLVDGPFDDPGWEYEVKWDGYRALAYLNNGEVKLQSR
NRKSFSDKFYPIYQQLQEWKINAVIDGEIVVINDKGLSDFNALQNWRSEADGELVYYAFD
IVWLEGKSLIHLPLSERKAILKSIVDENSPVQLGYSVEADGTAFFEAAQKMGLEGIMAKK
SDSEYYPGLRTRDWLKIKINKRQEVIIAGYTLNEGSSKLFSALLLAAYADGELQYVGKVG
TGFKEKQQKEMMALFKPLIAKKSPFKETPDYNKPSRFRPNPPHANATWLKPELVCEISFT
EITADGVFRHPSFEGMREDKSAKEVVREVEKPAEEIVDDANEQSETIIRKPGRAKRKTLL
NPKEETQVRKISGHEVKFSNLGKLYWPDDKIQKRELINYYYQVAPLILPYLENRPLSLNR
FPNGIRGKSFYQKDVTGKVPEWIETTPYVSEGENKNFMLCNDEATLLYMANLGAIDVNPW
NSRIETPDNPDWCLLDLDPDTTNTFEQVIETAQAIKNLLDSLGVPSYCKTSGSTGLHIYI
PLGAKYSYDQCQLFAEWVAGQVQQQLPDFTSVERLTKNRKGKLYIDYLQNRPKATLAAPY
SVRPKPGATVSMPLHWEEVKVGLQLKDFTIYNAMDRIQREGDLFKPVLGEGIDLEEVIAK
MG
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgacactttccaagtacaacgaaaaacgcaaattcgacaaaacgcctgagccgaagggc
ggcaagggcgataacgacgagcttatttttgtgatccagaaacacgatgccacgcgcctg
cattatgatttcaggctggaaatggaaggcgtgctcaaaagctgggcggtcccgaaaggt
ccttccacggacccgtcggtgaaacgtctggcgatgatggtggaagaccatccgtacgat
tacaaggatttcgagggcattatccccaagggaaactatggcgcggggacggttatggtg
tgggatttcggcacgtatgagcccttggaagaagtaaatggaaaattgaaagctgttaaa
ggcaaaaaagcccgggaaaaactggcgctgaaagagctgcattcgggctcgctgaaagtg
cggctgaatggcaagaaagtgaaaggcgaatatgcattggtgaaaacgaaaggcatggag
gagaacgcgtggctgctgatcaagcaccgcgacaaatacgcatctgaggacgacattacc
gagaaagaccgctcggccgtttcccgacgcacgctcgccggcatcgaaaaggccggtgac
gccatttgggaaagcaatcacgaagaaaagaaatcaaccaaaggcaaaacgaaagccgct
aaaaccgaagcgaaagatcctgccgaagaagccgccactgaaaaaaaaagtccggacgag
gacatagcagccattctgaaaaagggcaaaaagcaaaagtttccggatgacctgcaaccg
atgctcgctacgctggtagacgggccgttcgacgatcccgggtgggaatatgaggtaaaa
tgggatggataccgggcattggcctatctcaacaatggggaggtaaagctgcaatcgcgg
aacaggaaatcgttcagcgacaaattttatcctatttaccagcaattgcaggaatggaaa
atcaatgcggtgatcgacggcgaaattgtggtgatcaacgacaaaggcctttcggatttc
aatgcgctgcaaaactggcgcagcgaggccgacggcgaactggtgtattacgctttcgac
attgtgtggctcgaaggcaagagccttatccatttgccgctgagcgaacgaaaagctatt
ttgaaaagcattgtggatgaaaacagtccggtacagctcggttacagcgtcgaagcggac
ggtactgcgttttttgaagcagcgcagaagatgggcttggagggcattatggccaaaaaa
tccgacagcgaatattaccccggcctccgcacgcgcgactggctaaaaatcaagatcaac
aaacggcaggaggtgatcatcgccggttacaccctgaacgaaggctcatccaagctgttc
agcgcgctgctgctggctgcctatgccgatggcgagctgcaatatgtgggcaaagtaggc
acgggtttcaaggaaaaacagcaaaaggagatgatggcgctcttcaagccgctgatcgcc
aagaaaagtcctttcaaagaaacccccgattacaacaagccctcgcgcttccgtcctaac
ccgccccacgcgaatgcgacctggttgaaaccggagctggtgtgcgagatcagctttacg
gaaattacggccgacggcgtgttcaggcatccgtcgtttgagggaatgcgcgaggataaa
tcggcgaaggaagtggtgcgggaggtggaaaaaccagcggaggaaatcgtggacgacgcg
aatgagcagagcgagaccatcatccggaaaccgggcagagcgaaacggaagacgcttttg
aaccctaaggaagaaacgcaggtgcgcaaaatcagcggacatgaggtgaaattctcaaat
ctgggaaaactctactggcccgacgacaagatccagaagcgtgagctgattaactattac
taccaggttgcgccgctgattctgccctacctcgaaaaccgcccgctctcgctcaaccgc
ttcccgaacggcattaggggcaagagtttttaccaaaaagatgtgacgggcaaagtgccg
gaatggatcgaaacgacgccctatgtttcggagggtgagaacaaaaacttcatgctctgc
aacgacgaggccactttgctttatatggctaacctgggggcgattgacgtgaacccctgg
aacagccgcattgaaacgcccgacaatcccgactggtgcctgctcgacctcgaccctgac
acgaccaacactttcgaacaagtgatagaaaccgcgcaggccattaaaaacctcctggat
tcgcttggcgtaccatcttattgcaaaacctccggctccaccggcttgcacatttacatc
ccgctgggcgcgaaatacagctacgaccaatgccagctcttcgccgaatgggtagctggc
caggtgcagcagcagctccccgatttcacgagtgtggagcgcctgaccaagaaccgcaag
ggcaagctttacatcgattacctccaaaatcgccccaaggcgacattggccgccccctat
tccgtacgcccgaaacccggcgcgacggtgtcgatgcccttgcattgggaggaggtgaaa
gtgggcctgcaactgaaagatttcacgatttacaatgccatggaccgcattcaacgggaa
ggcgaccttttcaaaccggtgttgggtgaagggatcgacctggaagaggtgattgctaaa
atgggctga

DBGET integrated database retrieval system