KEGG   Dyadobacter fermentans: Dfer_3929Help
Entry
Dfer_3929         CDS       T00970                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dfe  Dyadobacter fermentans
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dfer_3929
  Energy metabolism
   00680 Methane metabolism
    Dfer_3929
Enzymes [BR:dfe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Dfer_3929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4777255..4779837
Genome map
AA seq 860 aa AA seqDB search
MNNSFQDAVVTKYNIFNSLFLSLPYRGIFQTGSLLPILTQQSENGFQEGKSPKEIIEHFF
SELLETATPKERADLLFAFIQYIERQVVLFDSVEDAAFDETHDLTGKGSVTYLTERLESD
ELKKKLLAKLEDFSVRIVLTAHPTQFYSGKVLGIINDLEDAIKENDFAEVNQLLLQLGKT
AFINHEKPTPFDEAVSLCWFLENVYYDAIPSILEKLINGLGMSVHDWPYPNVFRLGFWPG
GDRDGNPFVNPDITLKVAARLRETLLRGYYRDLRQLKRRLTFKGVDDAISLAEKKMNSTI
FGPFEEGYNNAQELIDEFLKAREVLVNKHQGLFVELLDNFILKLNLFGFFFASLDVRQDS
RKHGKAWEDILKRLEKKIPLLKYSDYEGWDEAKKIDLLLSLNIPLRDEDYEDELTKDILG
SIRAIKTIQEANGEKGAHRYVISNNTSALNVMQVVALAKNLIADEAGKLALDVVPLFETV
DDLANAPGIMRTLYENDYYRNHLSNRENHQTIMVGFSDGTKDGGYLRANWSIYRAKEELT
KVSREFGIKVTFFDGRGGPPARGGGNNHNFYSSLGKDIEDKEIQLTVQGQTISSNYGTVT
TAMYNLERLFTAGLENHLFKGHREDELTEADKELIEEMAEIAYNSYLDLKNHPMFVKYLD
KKTPLRFYGQTNIGSRPTKRGNDDEGLKFEDLRAIPFVGSWAQMKQNVPGFYGFGTAIRE
LGKTNKVDEIKKLYQKSLFFRTLIENSMQSLSKAFFPATKYLRDEEEYREFWDKMYEEFL
LTRELLLEVSGQKELLDSNNVTKVSIKTRERIVLPLITIQQYALQMLSGDPKDLPVDVET
YNQLIIRAMFGIINAARNSA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagtttccaggacgcagttgtaacgaagtataatatttttaatagcctgttt
ctgagcttgccctaccgaggtatctttcaaacaggctctttgcttccgatactgacccaa
caaagcgagaacggctttcaggaaggcaaatctcccaaggaaatcatcgagcattttttt
tcagagctcctggaaacggctactccaaaggaacgtgctgatttactttttgcatttatc
caatatatcgaacgccaggtcgtgctgttcgactcggtggaggatgcagcgttcgacgaa
acgcatgaccttacgggcaaaggttcggttacctaccttaccgaacggctcgaaagcgac
gaactgaaaaagaaattgctcgccaagctggaagatttcagcgtccggattgtgctcacg
gcccatccgacgcaattttactccggcaaagtgctcgggatcatcaacgacctcgaagac
gcgatcaaggaaaacgacttcgcggaagtgaaccagttattgctccaacttggaaaaacc
gcatttatcaaccacgaaaagccaacgccgttcgacgaggcggtgagcctgtgctggttc
ctcgaaaatgtatattacgacgccatcccgtctatcctggaaaagctcattaacgggctg
ggaatgagcgtacacgactggccttacccgaatgtgttccgcctgggcttctggcccggt
ggcgaccgcgacggtaacccgttcgtaaaccccgatattaccctgaaagtagcggcgcga
ctgcgtgaaacgctgctccgcggctattaccgcgatctgcgccaattgaaacgccgcctt
acattcaaaggagtggacgatgcgatttcgctggccgagaaaaagatgaacagcaccatt
ttcgggccgttcgaggaaggttataacaatgcgcaggagctgatcgacgaatttttgaaa
gcccgcgaagtgcttgtgaacaagcatcaggggctattcgtggagctgctcgacaatttt
atattgaaactgaacctgttcggattcttcttcgcgagcctcgatgtgcgtcaggacagc
cgcaagcacggcaaggcctgggaggacattttgaaaagactcgaaaagaaaattccgctg
cttaaatacagcgattacgaaggctgggacgaagcaaaaaagatcgacctgctgctttcg
ctcaacattccgcttcgggatgaagactacgaggacgaacttacgaaagacattctcggc
tcgatccgggccattaaaacgatccaggaagcgaacggcgaaaaaggcgctcatcgctac
gtgatcagcaacaacacttcggcattgaatgtaatgcaggtggtggcgctggccaaaaac
ctcatcgccgacgaagccggcaagctggcgctcgacgtggttccgcttttcgaaaccgta
gatgacctcgcgaatgcaccgggcattatgcgcacgctctacgaaaatgactattaccgc
aaccatttgagcaaccgtgaaaaccaccagacgatcatggtaggcttctcggatgggacc
aaagacggcggttatctgcgcgccaactggtcgatctatcgtgcgaaggaggagttgacc
aaagtttcgcgtgaatttgggatcaaagtgacgttcttcgacggccgtggaggacctccg
gcacgcggcggcggcaataaccataacttctattcgtcgcttggcaaagatatagaggat
aaagaaatccagctaaccgttcagggccagactattagctcgaactacggaacggttacc
acggcgatgtacaacctggaaaggctcttcaccgccggccttgaaaaccaccttttcaaa
ggccaccgcgaggacgaactgacagaagccgacaaagagctgatcgaagaaatggctgaa
atcgcctacaattcttacctcgatctgaaaaatcacccgatgttcgtcaaatacctcgac
aaaaagacgccactgcgtttttacggacagaccaacatcggaagccgtcctacgaaacgc
ggcaatgatgacgaagggttgaagttcgaggacctgcgcgcgattccgttcgtaggctca
tgggcgcagatgaagcagaacgttcctggtttctacggctttggaacggccatccgcgag
ttgggaaaaacgaacaaggtcgacgaaatcaaaaagttatatcaaaaatccctgttcttc
cggacgctcatcgaaaattcgatgcagtcgctctcgaaggcattcttcccggccacgaaa
tacctgcgcgacgaggaagaataccgcgagttctgggataaaatgtacgaggaattcctc
ctcacacgcgagcttctgctggaagtctccggccagaaagagcttttggacagcaacaac
gtcaccaaagtctcgatcaaaacccgcgaacgcatcgtactgccgctgatcaccattcag
caatatgcattgcaaatgctctccggcgatccgaaagatttgccggtggatgtggaaacc
tacaaccagctgatcatccgggccatgttcgggatcatcaacgcggcacggaattcggcg
tag

DBGET integrated database retrieval system