KEGG   Dickeya fangzhongdai: CVE23_00955Help
Entry
CVE23_00955       CDS       T05277                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dfn  Dickeya fangzhongdai
Pathway
dfn00620  Pyruvate metabolism
dfn00680  Methane metabolism
dfn01100  Metabolic pathways
dfn01120  Microbial metabolism in diverse environments
dfn01200  Carbon metabolism
Module
dfn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dfn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CVE23_00955
  Energy metabolism
   00680 Methane metabolism
    CVE23_00955
Enzymes [BR:dfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CVE23_00955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATZ92673
UniProt: A0A2K8QGN8
LinkDB All DBs
Position
complement(209300..211939)
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGANILERVETIRKLSKASRAGSETHRQELLTTL
QNLSNEELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALATVFRNLKSRDNLSDK
DIRDAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHDDLADYERHQIMRRLRQ
LIAQYWHTDEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLRELDEQMDKELGYRLPVDS
VPVRFTSWMGGDRDGNPNVTAEVTRRVLLLSRWKAADLFLRDVQVLVSELSMTTCTPELQ
QLAGGDEVQEPYRELMKTLRAQLTATLNYLDARLKGEQLVAPKDLLVTNEQLWDPLYACY
QSLHACGMGIIADGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDALAEITRYLGLGDYES
WSESDKQAFLIRELNSKRPLLPRQWEPSADTQEVLETCRVIAETPRDSIAAYVISMARTP
SDVLAVHLLLKEAGCPYALPVAPLFETLDDLNNADSVMIQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYRAQDALIKTCEKYGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKFGLPEVTISSLSLYTSAILEANLLPPPEPKQEWHHIMNEL
SRISCDMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVIDDGHQNQLEDMCRDWPFFSTRIGMLEMVFAKADLWLAE
YYDQRLVEEKLWSLGKQLREQLEKDIKAVLTISNDDHLMADLPWIAESIALRNVYTDPLN
VLQAELLHRSRQQDTLDPQVEQALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaatattccgccatgcggagcaatgtcagcatgctgggtaaattgctcggc
gacaccatcaaggatgcgctgggcgccaatatccttgagcgtgttgaaacaatccgcaag
ctgtccaaagcctcgcgagccggcagcgaaacacaccgtcaggaactgctgaccacactg
cagaacctgtccaacgaggaactgctgccggtcgcccgcgcgttcagccagttccttaac
ctgaccaacacggcggagcagtaccacagcatttctccgcacggcgaggcggccagtaac
ccggaagcgctggcgacggtgtttcgcaacctgaaaagccgcgacaatctgagcgacaag
gacatccgcgacgcggtggaatcgctctccatcgagctggtgctgaccgcgcacccgacc
gaaatcacccgccgcacgttgatccacaaactggttgaagtgaatacctgcctcaagcag
ctcgaccacgacgatctggccgactatgaacgccatcagatcatgcgccgtctgcgccag
ttgatcgcccagtactggcataccgatgaaatccgcaaaatccgcccgacgccggtggac
gaagccaagtggggcttcgcggtggtggagaacagcctgtgggaaggggtgccggcgttc
ctgcgcgaactcgacgaacagatggacaaggaactcggttatcgtctgccggtggattcg
gtgccggtacgcttcacctcctggatgggcggcgaccgcgacggcaacccgaacgtgacc
gctgaagtcacccgccgcgtactgctgttaagccgctggaaagccgccgatctgttcctg
cgcgacgtacaagtactggtgtccgagctgtcgatgaccacctgtaccccggagctgcaa
cagctggcgggcggcgacgaggtgcaggaaccctaccgcgagctgatgaaaacgctgcgc
gcgcagttgaccgccaccctgaactatctggacgcgcgtctgaaaggcgagcaactggtc
gcgcccaaagatctgctggtcaccaacgagcagttgtgggatccgctgtacgcctgttac
cagtcgctgcatgcctgcggcatgggcatcatcgccgacggtcagttgctcgacaccctg
cgccgggtacgctgcttcggcgtgccgctggtgcgtatcgacgtacggcaggagagcacc
cgtcacaccgacgcgctggcggaaatcacccgctatctggggttgggagactacgaaagc
tggtcggaatccgacaaacaggcgttcctgatccgcgagcttaactccaagcgtccgctg
ctgccgcgtcagtgggaacccagcgccgacacgcaggaagtgctggaaacctgccgggtg
atcgccgaaaccccacgcgattccatcgccgcctacgtgatctcgatggcgcgcaccccg
tccgacgtgctggcggtgcatctgctgctgaaggaagccggctgcccgtacgcgctgccg
gtggcgccgctgttcgaaacgctggacgacctgaataacgccgacagcgtcatgatccag
ttgctcaacatcgactggtatcgcggcttcattcagggcaaacagatggtgatgatcggc
tattccgactccgccaaagacgccggggtgatggccgcctcctgggcccagtaccgcgcg
caggacgcactgatcaagacctgtgagaaatacggcatcgcgctgacgctgttccacggt
cgcggcggctccatcggccgcggcggcgcgccggctcatgccgcgctgctctcccaaccg
ccgggaagcctgaaaggcggcctgcgcgtcaccgaacagggcgagatgatccgcttcaag
ttcggtctgccggaagtcaccatcagcagcctgtcgctctacacctccgctattctggaa
gccaacctgctgccgccgccggaaccgaagcaggaatggcatcacatcatgaacgagctg
tcgcgcatttcctgcgacatgtaccgcggctacgtgcgggaaaacccggacttcgtgcct
tatttccgcgccgccacgccggaactggaactgggtaaactgccgctggggtcgcgcccg
gctaaacgccgaccgaacggcggcgtggaaagcctgcgcgccatcccgtggattttcgcc
tggacccagaaccgcctgatgctgcccgcctggctgggcgccggcgccgcgctgcaaaaa
gtgatcgacgacggtcaccaaaaccagctggaagacatgtgccgcgactggccgttcttc
tccacccgcatcggtatgctggagatggtgttcgccaaggccgacctgtggctggcggaa
tactacgatcaacggctggtggaagagaaactgtggtcgctcggcaaacagctgcgcgag
cagttggaaaaagacatcaaggcggtactgaccatctccaacgacgaccatctgatggct
gacctgccgtggatcgccgaatccatcgcgctgcgcaacgtctacaccgacccgctcaac
gtgttgcaggcggaactgttgcaccgttcgcgtcagcaagacactctggatccgcaggta
gagcaggcgctgatggtcaccatcgccggcgtcgccgccgggatgcgcaataccggctaa

DBGET integrated database retrieval system