KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17988Help
Entry
Dmel_CG17988      CDS       T00030                                 

Gene name
Ance-3
Definition
(RefSeq) Ance-3, isoform B
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dmel_CG17988 (Ance-3)
Peptidases [BR:dme01002]
 Metallo Peptidases
  Family M2
   Dmel_CG17988 (Ance-3)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG17988 (Ance-3)
CD molecules [BR:dme04090]
 Proteins
  Dmel_CG17988 (Ance-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
2L
AA seq 844 aa AA seqDB search
MHSVSLLGCLCLSLSLTLSTGSPQLNLPTPQPEVFYNGYTPNVATTPAQLRADRDRDQRY
GPPYSDAGGGGNTDDGLDDFRFGQTDDERMRIGYGYPTPRVNFSDSPFSGARFSNHNYGP
ISSTTERNYGNDANLNGRYSDVPYSSQGERNFNPNDQYNYNNNPNVEFVGINNRNRFENP
FLSNQDRFNLNQGYLERQRYQQDRRYQQELEKLRILLVESDQKGSLECTANVAAQWNFET
NVNDFTQTEALNAQQRYVEFQRITAEQSKRINKDLIFDRRLYRQLMLQSEVGPNALPLDV
LDRYNRLLNEMLFLYNSAEICAYQQPFQCDLHYIPQLKDIMAKSRDWDELQHTWVEYHRK
AGRGMRDSYEQLIDVMQEVAYVNNVTNGGEYWYLAYESGNFRQDMDIVWEQIRPLYEGLH
AYVRRKLRDYYGPDRINRIAPIPSHILGNMYGQSWSNVLDILIPYPGRKLIDVTPRMVEQ
GYTPQLMFQLAEEFFTSINMSAVGPEFYRNSIFEQPLDRRVLCEPSAWDFCNRHDFRVKI
CTDINQRSLISVHHEMAHIQYFLQYRHLPKIFRNGANPAFHQAVGDAIGLSVSTPRHLQT
LGLLQRSLDESSYDINYLFTMAIDKVAFLPFALSLDNWRYDVFSGNANKRTMNCHYWNLR
EKYSGIKPPVLRSEKDFDPGAKYHIPANIPYIKYFFSTVLQFQIYRGLCRESGQYVPGDP
RKPLHQCDIYRQPAAGNILKTLMSKGASQPWQEVLEETLREGRLDGTALREYFAPLEEWL
RQENLRTNEYVGWNYDGDYCKRSIETAGLQVFGGYYNGATGQKSAPFLYPLILLIYLYFS
LRLL
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtgtttcgcttttgggctgtctttgcctcagccttagcctgactttgagtacg
ggcagtccccaactgaatctgcccaccccgcagcccgaggtcttctacaatggatacacc
ccgaatgtggccacaactccggcccagcttcgagcggatcgggatcgcgatcagcgctac
ggaccaccttactccgatgcaggtggaggtggcaacaccgacgacggactcgacgacttt
aggtttggccagacagatgacgaacggatgaggatcggctatggctatcccacgccccgc
gtgaactttagtgattcacccttcagtggggctaggttttccaaccacaactatggaccc
atttccagtaccaccgaacgtaattacggcaacgacgccaatctcaatggacgctattcg
gatgtgccctactcctcccaaggagagcgtaacttcaatcccaacgatcagtacaactac
aataataatccgaatgtggaatttgtgggcattaacaatcgcaatcgcttcgagaatccc
ttcctttcgaaccaggatcgtttcaatctaaatcagggctacttggaacgtcagcgatat
cagcaggatcgtcgctatcagcaggagttggagaagctgcgcatcctgctggtggagtcg
gatcagaaaggatcactggagtgcaccgccaatgtggctgcccagtggaacttcgagacg
aatgtgaatgattttacccaaacggaagcgctaaatgctcaacagcgatatgtggagttc
cagcgcatcactgccgagcaatccaagcggatcaataaggatctcatcttcgaccgtcgc
ctctacagacaactgatgctgcagtcggaagtgggacccaatgctctgcccctagatgta
ttggataggtataatcgcctgctcaatgagatgctgttcctgtacaacagcgccgaaatc
tgtgcctaccagcagccctttcagtgcgatcttcactacataccccagctgaaggacatc
atggccaagagcagggactgggatgagctgcagcacacttgggtggaataccacaggaag
gcgggacgcggaatgcgggatagttatgagcagttgatcgatgtgatgcaggaggtggcc
tacgtaaacaatgtcactaatggcggggagtattggtatttggcctacgagtcgggtaac
tttcgccaggatatggacattgtttgggaacagataaggcctctttacgaaggattgcat
gcctatgtacgtcgcaagctgagggattactatggtccagatcggataaaccgcatagca
cccattccctcgcacattctgggcaacatgtacggccagtcgtggtccaatgtgttggac
attttgataccctatccaggccggaagctgatcgacgtcacgccgcgaatggtggaacag
ggctacacaccgcaactgatgttccagttggccgaggagttcttcacctccattaatatg
tctgcggtgggtccggagttctatcgcaactccatcttcgaacagcccctggatcggagg
gtcctgtgtgagccatccgcctgggacttttgcaatcgtcacgatttccgcgttaaaatc
tgtacggatatcaatcagcgaagtttgattagtgtgcaccatgagatggcgcacattcag
tactttctgcagtatcgtcacctgcccaagatcttcagaaatggagcgaatccggcattt
caccaggcggtgggcgatgccattggcctgtccgtatcaactccaaggcatttgcagact
ctgggactactacaaagatccctcgatgagtccagctatgatattaactatctgttcacc
atggccattgacaaggtggcatttttaccttttgcattatctctggacaattggcggtat
gatgtctttagtggcaatgcgaataagcgaacaatgaactgtcactactggaatttacga
gaaaagtattccggtataaagcccccagttttgcgatcagaaaaggatttcgacccggga
gccaaataccatataccagcaaatattccctatatcaaatactttttctccacggttctg
cagttccagatctatcgaggcctgtgccgcgagtccggccagtatgtgcccggtgatcct
aggaagccgctccaccaatgcgacatttatcgccagccagcagcgggaaatattctcaaa
accctgatgtccaagggagcctcccagccatggcaagaggtccttgaggaaaccctgagg
gagggtcgcttggatggaaccgctctgcgggagtactttgctccactggaggaatggctg
cgccaggagaatctgcggacgaacgagtatgtgggatggaactacgatggtgactactgc
aagaggagcatcgaaactgctggcttgcaggtctttggtggatattacaatggtgcgacg
ggacaaaagtcagcgccattcctatacccactgatcttgctgatttacctttacttcagc
ctacgtttattatga

DBGET integrated database retrieval system