KEGG   Dehalococcoides mccartyi GY50: GY50_0836Help
Entry
GY50_0836         CDS       T02938                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dmg  Dehalococcoides mccartyi GY50
Brite
Enzymes [BR:dmg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GY50_0836 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
779974..780552
Genome map
AA seq 192 aa AA seqDB search
MYTARDYSYLIGLEGFSDTLLRNHFTLYQGYVNNTNKLSDTLKTMLTEGKTATPEYAELK
RRFGFEYNGMRLHEYYFSNLGTSAPLSESNKLYQAISAEFGSYQLWEADFKATAAMRGIG
WVVLYKDSQTGRLFNQWINEHETGHLAGLSPILVIDVFEHAFITDYGLKRADYISAFIKN
TNWAEAENRFKA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtatacagcccgtgattattcgtacctgataggtctcgaaggattttctgatacactc
cttagaaatcactttaccttatatcagggttatgtaaacaacactaataaactttcagat
accttaaaaactatgctcaccgagggtaaaacagctactccagaatatgccgaactcaaa
cgccgatttgggtttgagtataacggtatgcgtctgcacgagtattacttttctaatctg
ggtacttctgcacccttatccgaatcaaacaaactttaccaggcaatatcagcagagttt
ggcagctaccagctctgggaagcagactttaaggctactgccgcaatgcggggaataggc
tgggtagtactctataaagattcccagacagggcggctttttaaccaatggataaacgaa
catgagaccgggcatctggcaggtttatctccgatattggtcatagacgtatttgaacat
gcctttattacagattacggtttgaaacgggcggattatatttccgccttcattaagaac
acaaactgggctgaagcggaaaaccgctttaaggcataa

DBGET integrated database retrieval system