KEGG   Drosophila mojavensis: Dmoj_GI17913Help
Entry
Dmoj_GI17913      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
dmo  Drosophila mojavensis
Brite
Enzymes [BR:dmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Dmoj_GI17913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 772 aa AA seqDB search
MTHWYRSYAPSWLQRWWQPPAPAKPINPYRSIRPGPDIANAGSSAVLGVQRVDLCLADNH
DEHHTSHFYAAAAKEALIVRRGEPFRLRIYFNRDYSPSKDAISFIFSVTDDNKPNPGHGT
LTALVPHDGIDFLGDPLEWGAGIESHEGQILTVLVKPPATCPVTEWRLDIDTKLLGDGSR
SYPLPLPIYILFNPWCPDDQVYMEDRDKRKEYVMHDTTLIWRGSYNRLRPSVWKVGQFER
HVLECSLRVLGTVGHIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWTEDFSGGTAPTK
WTGSVEILQQFYKTQKSVKFAQCWNFSGVLATIARALGIPSRIITCYSSAHDTQASLTVD
VFIDANNKKLDAETTDSIWNYHVWNEVWMQRPDLGIGQYGTYDGWQVVDATPQEASDNMY
RVGPASVLAVKHGEILRPFDCGFVYSEVNADKLYWRYNGPAQPLKLLRKDTLAIGQLIST
KAVLKWEREDITDSYKYAERSEEERSYMLKALKQSRHAFSRYYLNDNFNEVEFSMELKDD
IKVGENFSVVLKVTNKSQERIHQATGQLNCDAVLYTGVGAHEVKTMGFELDLKPNSTEFV
RMEVTFFEYFEKLSSQAAFQISAACRVKDTDYDYYAQDDFRVRKPDIKLQLGNGDNASIV
SQQEIDIILRLTNPLPIALHKGLFTVEGPGIELPLKFKIPEVPVGGTAAATFKYVPPYAG
RGTMIAKFTSKELDDVDGYKHYEIEPRPGDMLQPNGSHRSSNIIRRRTDVIP
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgacccattggtatcgcagctatgcgcccagttggctgcagcgctggtggcaaccgccg
gctcctgccaaaccaataaatccctaccgaagcatacgtcccggtcccgatattgcaaat
gccggtagctctgcggtgctgggcgtgcagcgtgtggatctctgcctggcggacaaccat
gacgagcaccacacgagccacttctatgcggcagctgccaaggaggcgctaatcgtgcgg
cgaggcgaaccatttcgtttgcgcatctacttcaatcgggattacagccccagtaaagat
gcaattagcttcatattcagcgtgacggacgataacaagccgaacccgggacatggcact
ctgacggctctggtgccgcacgatggtatcgattttctgggcgatccattggaatggggc
gccggcattgaatcgcacgagggtcaaatattaacagtactagtgaagccaccggccaca
tgtccggtaaccgagtggcgtctggacattgacacgaagctgctgggcgatggctcgcgc
agctatccattgccactgcccatctatatactctttaatccctggtgtccggacgatcag
gtttacatggaggaccgggataagcgcaaggagtatgtgatgcatgatacgactctgatt
tggcgtggctcctacaatcgactgcgtccctcagtctggaaggttggccaattcgagcgc
catgtgctcgagtgcagcctgcgagtccttggaacagtgggacacattccacctgcctac
cgaggcgatccggtgcgtgtggcacgtgctctatctgctctggtgaactccgtggatgat
gatggtgtgctgttgggcaactggaccgaggatttctcgggcggcacagcgcccaccaag
tggacgggctctgtcgagatcttgcagcagttctacaagacccagaagtcggtgaagttc
gctcaatgctggaatttcagtggtgtcctggccacgattgcacgtgccttgggcattcct
tcacgcattattacatgctactcctctgcccatgatacgcaagcgtcgctgactgtcgat
gtgttcatcgatgccaacaataagaaactggatgcggagacaacggactccatatggaac
tatcatgtgtggaacgaggtgtggatgcagcgtcccgacttgggcattggacagtacgga
acatacgatggctggcaggtggtagatgcgacgccacaggaggcatcggataatatgtac
cgagtgggtcccgcctcagtgctggcagtgaagcatggcgagattctgcgtcccttcgac
tgcggctttgtctactcagaggtgaatgccgataagctctattggcgttacaatggaccc
gcccagccgctaaagctgttgcgcaaggacactctggccattggccagttgatcagcacc
aaggcggtgctgaagtgggagcgtgaggatatcaccgatagctataaatatgccgagcgc
agcgaggaggagcgcagctatatgctgaaggccttgaagcaatctcgtcatgctttcagt
cgctattatttgaatgataacttcaacgaggtggagttcagcatggagctgaaggacgac
atcaaggtgggcgagaacttctcggtggtgctcaaggtgaccaacaagagccaggagcgc
attcatcaagccaccggccagcttaactgtgatgcagtgctctatacgggcgtgggcgca
catgaggttaagaccatgggcttcgagctggatctgaaaccgaatagcacggagtttgtg
cgcatggaggtcacattcttcgaatactttgagaaattgtcctcgcaggcggctttccag
atctctgcggcctgtcgcgtcaaggataccgactacgattattatgcccaggacgatttc
cgtgtgcgcaagccggacattaagctgcaactgggcaatggtgacaacgccagcatcgta
tcacagcaggaaatcgatataatattgcgcctgaccaatcctctgcccatagcactccac
aaagggttattcacagtggaaggtcctggcatagagctgccactcaaatttaagattcct
gaagtaccagtgggtggcacggccgctgcgacatttaagtatgtcccaccatatgccggc
cgagggacaatgatagccaagttcacttccaaggagctggacgatgtggatggctacaag
cactatgagattgaaccgcgacccggcgatatgctgcaacccaatggcagccatcggagc
agcaatatcatacgccggcgcacggatgtcattccctga

DBGET integrated database retrieval system