KEGG   Drosophila mojavensis: Dmoj_GI22624Help
Entry
Dmoj_GI22624      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
dmo  Drosophila mojavensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmoj_GI22624
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmoj_GI22624
   00051 Fructose and mannose metabolism
    Dmoj_GI22624
   00052 Galactose metabolism
    Dmoj_GI22624
   00500 Starch and sucrose metabolism
    Dmoj_GI22624
   00520 Amino sugar and nucleotide sugar metabolism
    Dmoj_GI22624
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dmoj_GI22624
Enzymes [BR:dmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dmoj_GI22624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 451 aa AA seqDB search
MDEVRTLYPDAYKICQQFEIDQHKMEEIILRMTREISMGLAKDTHSRATIKCFVTYVQDL
PTGRERGRYLALDLGGTNFRVLLVTLESESTVNIDGKTYGISKELMEGSGVKLFDFIAQC
LSDFCKDHKLENANLSLGFTFSFPCKQLGIDNGTLVAWTKGFKADGVVNKNVVELLREAI
TRRGDLKVQVVAILNDTTGTLMSCAFTRQNCKIGMIVGTGSNACYVEKTSNVEMFPGYQN
SPKPHMIINCEWGAFGDNGVLDFVRTRYDVEVDSHSMNPKKQIYEKCISGMYMGELVRYI
LVELMDRDVIFKGVKSQTLQQRGKFDTRFITEIESDEPGKFRNAAMVMDNLGIRTSNEKD
LMCLRYICETISTRSAKLAACGLVCLIRKMNVKDLAVGIDGSVYRFHPHYHRLLMQNMNL
LLNGTVRFELVLSEDGSGRGAALIAAVCAKD
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagtacggacactttaccccgacgcttataaaatttgtcagcagttcgagata
gatcaacacaaaatggaggaaattattctgcggatgaccagggaaatctctatgggtctt
gcaaaagatacgcattcacgagctacaataaaatgctttgtaacgtacgttcaagacctg
cccactggccgggagagaggaagatacctggcgctggatcttggaggaaccaactttcga
gtcctattggtcacgttagagtccgaatccactgttaatattgatggcaagacctacggc
attagcaaggagttaatggaaggctctggcgtcaaactattcgactttattgcgcagtgt
ctatctgacttttgcaaagatcataagctcgaaaatgctaatttgtctcttggcttcaca
ttctcttttccgtgcaagcagctaggtattgacaacggcactctagtcgcctggacgaag
ggcttcaaggctgatggagtggttaacaagaacgtcgttgagttgcttcgtgaagctatc
acgcgtcgaggcgaccttaaggtccaagtcgtggccattctcaacgatacgacgggaact
ttgatgtcctgcgcatttactcgccagaattgcaaaatcggaatgattgtgggcacgggc
agtaacgcctgctacgtggagaaaacatcgaatgtggaaatgtttccgggataccaaaac
agcccgaagccccatatgatcatcaactgcgagtggggcgctttcggggacaatggcgta
ctggactttgtgcgcactcgctacgatgttgaggtggacagtcattccatgaatcccaag
aaacagatttacgagaagtgcatctctggcatgtacatgggagagttggtgcgttacatt
ttggtggagttgatggacagggacgtgattttcaagggagtgaagtcacagacccttcag
caaagaggcaaatttgatactcgttttataacggagatcgagtccgacgagccgggaaag
tttcgcaatgctgcaatggtaatggataatctgggcattagaacttccaacgaaaaggat
ttaatgtgcctgcgctacatatgtgaaactatatccacgcgttccgctaaattggcagcc
tgtggactggtctgtttgatcaggaaaatgaatgtcaaggacttggcagtgggtattgat
ggtagtgtttatcggtttcatccccattaccataggttgttaatgcaaaatatgaactta
ctgctgaatggcactgtaagatttgagttggttctgtctgaagatggttcgggccgtgga
gccgcgctcattgcagccgtttgtgcgaaagattag

DBGET integrated database retrieval system